P04370: Myelin basic protein (Mouse)

Protein names
  • Myelin basic protein (MBP)
  • Myelin A1 protein (MBP)
  • MBP
Gene names Mbp (Shi)
Organism Mus musculus
Protease Family (Not Available)
Protease ID (Not Available)
Chromosome 18

Isoforms

  • Isoform 2 of Myelin basic protein (P04370-2): sequence view | extended view
  • Isoform 3 of Myelin basic protein (P04370-3): sequence view | extended view
  • Isoform 4 of Myelin basic protein (P04370-4): sequence view | extended view
  • Isoform 5 of Myelin basic protein (P04370-5): sequence view | extended view
  • Isoform 6 of Myelin basic protein (P04370-6): sequence view | extended view
  • Isoform 7 of Myelin basic protein (P04370-7): sequence view | extended view
  • Isoform 8 of Myelin basic protein (P04370-8): sequence view | extended view
  • Isoform 9 of Myelin basic protein (P04370-9): sequence view | extended view
  • Isoform 10 of Myelin basic protein (P04370-10): sequence view | extended view
  • Isoform 11 of Myelin basic protein (P04370-11): sequence view | extended view
  • Isoform 12 of Myelin basic protein (P04370-13): sequence view | extended view
  • Isoform 13 of Myelin basic protein (P04370-14): sequence view | extended view

Sequence

        10         20         30         40         50         60 
MGNHSGKREL SAEKASKDGE IHRGEAGKKR SVGKLSQTAS EDSDVFGEAD AIQNNGTSAE 
        70         80         90        100        110        120 
DTAVTDSKHT ADPKNNWQGA HPADPGNRPH LIRLFSRDAP GREDNTFKDR PSESDELQTI 
       130        140        150        160        170        180 
QEDPTAASGG LDVMASQKRP SQRSKYLATA STMDHARHGF LPRHRDTGIL DSIGRFFSGD 
       190        200        210        220        230        240 
RGAPKRGSGK DSHTRTTHYG SLPQKSQHGR TQDENPVVHF FKNIVTPRTP PPSQGKGGRD 
       250    
SRSGSPMARR 

Annotation ?

Network neighborhood
[show protein-protein interactions]
(RSVGK(34)|(35)LSQTA)
34,250

Matrix metalloproteinase-25 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-9 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-14 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Targeted features: ?

34,250,250,1 CHAIN - Myelin basic protein. (1|250)
34,250,133,1 VAR_SEQ - Missing (in isoform 4, isoform 5, isoform 6, isoform 7, isoform 8, isoform 9, isoform 10, isoform 11, isoform 12 and isoform 13). (1|133)
 
(ADPKN(75)|(76)NWQGA)
75,250

Matrix metalloproteinase-25 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-15 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-16 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Neutrophil collagenase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Macrophage metalloelastase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-17 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-9 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-14 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Targeted features: ?

75,250,250,1 CHAIN - Myelin basic protein. (1|250)
75,250,133,1 VAR_SEQ - Missing (in isoform 4, isoform 5, isoform 6, isoform 7, isoform 8, isoform 9, isoform 10, isoform 11, isoform 12 and isoform 13). (1|133)
75,250,250,48 VAR_SEQ - EADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNR PHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASG GLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGIL DSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRT QDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR -> LTHENYPLWLPAPEVAARPDPR (in isoform 3). (48|250)
 
(ADPGN(87)|(88)RPHLI)
87,250

72 kDa type IV collagenase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-17 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-9 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-14 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Targeted features: ?

87,250,250,1 CHAIN - Myelin basic protein. (1|250)
87,250,133,1 VAR_SEQ - Missing (in isoform 4, isoform 5, isoform 6, isoform 7, isoform 8, isoform 9, isoform 10, isoform 11, isoform 12 and isoform 13). (1|133)
87,250,250,48 VAR_SEQ - EADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNR PHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASG GLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGIL DSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRT QDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR -> LTHENYPLWLPAPEVAARPDPR (in isoform 3). (48|250)
 
(DRPSE(113)|(114)SDELQ)
113,250

Matrix metalloproteinase-14 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Targeted features: ?

113,250,250,1 CHAIN - Myelin basic protein. (1|250)
113,250,133,1 VAR_SEQ - Missing (in isoform 4, isoform 5, isoform 6, isoform 7, isoform 8, isoform 9, isoform 10, isoform 11, isoform 12 and isoform 13). (1|133)
113,250,250,48 VAR_SEQ - EADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNR PHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASG GLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGIL DSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRT QDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR -> LTHENYPLWLPAPEVAARPDPR (in isoform 3). (48|250)
 
(SESDE(116)|(117)LQTIQ)
116,250

Matrix metalloproteinase-25 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-15 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-16 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Neutrophil collagenase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Macrophage metalloelastase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

72 kDa type IV collagenase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-17 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-9 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-14 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Targeted features: ?

116,250,250,1 CHAIN - Myelin basic protein. (1|250)
116,250,133,1 VAR_SEQ - Missing (in isoform 4, isoform 5, isoform 6, isoform 7, isoform 8, isoform 9, isoform 10, isoform 11, isoform 12 and isoform 13). (1|133)
116,250,250,48 VAR_SEQ - EADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNR PHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASG GLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGIL DSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRT QDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR -> LTHENYPLWLPAPEVAARPDPR (in isoform 3). (48|250)
 
(DELQT(119)|(120)IQEDP)
119,250

Matrix metalloproteinase-9 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Targeted features: ?

119,250,250,1 CHAIN - Myelin basic protein. (1|250)
119,250,133,1 VAR_SEQ - Missing (in isoform 4, isoform 5, isoform 6, isoform 7, isoform 8, isoform 9, isoform 10, isoform 11, isoform 12 and isoform 13). (1|133)
119,250,250,48 VAR_SEQ - EADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNR PHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASG GLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGIL DSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRT QDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR -> LTHENYPLWLPAPEVAARPDPR (in isoform 3). (48|250)
 
(EDPTA(126)|(127)ASGGL)
126,250

Matrix metalloproteinase-25 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Macrophage metalloelastase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

72 kDa type IV collagenase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-14 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Targeted features: ?

126,250,250,1 CHAIN - Myelin basic protein. (1|250)
126,250,133,1 VAR_SEQ - Missing (in isoform 4, isoform 5, isoform 6, isoform 7, isoform 8, isoform 9, isoform 10, isoform 11, isoform 12 and isoform 13). (1|133)
126,250,250,48 VAR_SEQ - EADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNR PHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASG GLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGIL DSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRT QDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR -> LTHENYPLWLPAPEVAARPDPR (in isoform 3). (48|250)
 
(LDVMA(135)|(136)SQKRP)
135,250

Matrix metalloproteinase-25 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-17 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Targeted features: ?

135,250,250,1 CHAIN - Myelin basic protein. (1|250)
135,250,250,48 VAR_SEQ - EADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNR PHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASG GLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGIL DSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRT QDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR -> LTHENYPLWLPAPEVAARPDPR (in isoform 3). (48|250)
 
(DVMAS(136)|(137)QKRPS)
136,250

Matrix metalloproteinase-14 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-25 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-17 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Targeted features: ?

136,250,250,1 CHAIN - Myelin basic protein. (1|250)
136,250,250,48 VAR_SEQ - EADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNR PHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASG GLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGIL DSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRT QDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR -> LTHENYPLWLPAPEVAARPDPR (in isoform 3). (48|250)
 
(PSQRS(144)|(145)KYLAT)
144,250

Matrix metalloproteinase-14 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-25 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-16 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Neutrophil collagenase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Macrophage metalloelastase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-17 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-9 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Targeted features: ?

144,250,250,1 CHAIN - Myelin basic protein. (1|250)
144,250,250,48 VAR_SEQ - EADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNR PHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASG GLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGIL DSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRT QDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR -> LTHENYPLWLPAPEVAARPDPR (in isoform 3). (48|250)
 
(QRSKY(146)|(147)LATAS)
146,250

Matrix metalloproteinase-17 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-9 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Targeted features: ?

146,250,250,1 CHAIN - Myelin basic protein. (1|250)
146,250,250,48 VAR_SEQ - EADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNR PHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASG GLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGIL DSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRT QDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR -> LTHENYPLWLPAPEVAARPDPR (in isoform 3). (48|250)
 
(RSKYL(147)|(148)ATAST)
147,250

Carboxypeptidase A6 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Fricker LD Lyons PJ et al.:Substrate specificity of human ... (M14.018) unknown none

Targeted features: ?

147,250,250,1 CHAIN - Myelin basic protein. (1|250)
147,250,250,48 VAR_SEQ - EADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNR PHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASG GLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGIL DSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRT QDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR -> LTHENYPLWLPAPEVAARPDPR (in isoform 3). (48|250)
 
(KYLAT(149)|(150)ASTMD)
149,250

Carboxypeptidase A6 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Fricker LD Lyons PJ et al.:Substrate specificity of human ... (M14.018) unknown none

Targeted features: ?

149,250,250,1 CHAIN - Myelin basic protein. (1|250)
149,250,250,48 VAR_SEQ - EADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNR PHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASG GLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGIL DSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRT QDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR -> LTHENYPLWLPAPEVAARPDPR (in isoform 3). (48|250)
 
(YLATA(150)|(151)STMDH)
150,250

Matrix metalloproteinase-14 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-15 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-16 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-9 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Targeted features: ?

150,250,250,1 CHAIN - Myelin basic protein. (1|250)
150,250,250,48 VAR_SEQ - EADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNR PHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASG GLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGIL DSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRT QDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR -> LTHENYPLWLPAPEVAARPDPR (in isoform 3). (48|250)
 
(DHARH(158)|(159)GFLPR)
158,250

Matrix metalloproteinase-9 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-14 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-25 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-17 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Targeted features: ?

158,250,250,1 CHAIN - Myelin basic protein. (1|250)
158,250,250,48 VAR_SEQ - EADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNR PHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASG GLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGIL DSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRT QDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR -> LTHENYPLWLPAPEVAARPDPR (in isoform 3). (48|250)

Affected feature boundaries: ?

158,250,157,157 MOD_RES - Citrulline (By similarity). (157|157)
 
(FLPRH(164)|(165)RDTGI)
164,250

Matrix metalloproteinase-9 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Targeted features: ?

164,250,250,1 CHAIN - Myelin basic protein. (1|250)
164,250,250,48 VAR_SEQ - EADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNR PHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASG GLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGIL DSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRT QDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR -> LTHENYPLWLPAPEVAARPDPR (in isoform 3). (48|250)

Affected feature boundaries: ?

164,250,163,163 MOD_RES - Citrulline (By similarity). (163|163)
 
(GILDS(172)|(173)IGRFF)
172,250

Matrix metalloproteinase-15 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Targeted features: ?

172,250,250,1 CHAIN - Myelin basic protein. (1|250)
172,250,250,48 VAR_SEQ - EADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNR PHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASG GLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGIL DSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRT QDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR -> LTHENYPLWLPAPEVAARPDPR (in isoform 3). (48|250)

Affected feature boundaries: ?

172,250,172,172 MOD_RES - Phosphoserine. (172|172)
172,250,172,172 MOD_RES - Phosphoserine. (172|172)
 
(DSIGR(175)|(176)FFSGD)
175,250

Matrix metalloproteinase-14 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Targeted features: ?

175,250,250,1 CHAIN - Myelin basic protein. (1|250)
175,250,250,48 VAR_SEQ - EADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNR PHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASG GLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGIL DSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRT QDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR -> LTHENYPLWLPAPEVAARPDPR (in isoform 3). (48|250)
 
(THYGS(201)|(202)LPQKS)
201,250

Matrix metalloproteinase-9 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-14 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Targeted features: ?

201,250,250,1 CHAIN - Myelin basic protein. (1|250)
201,250,250,48 VAR_SEQ - EADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNR PHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASG GLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGIL DSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRT QDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR -> LTHENYPLWLPAPEVAARPDPR (in isoform 3). (48|250)
201,250,250,191 VAR_SEQ - DSHTRTTHYGSLPQKSQHGRTQDENPVVHFFKNIVTPRTPP PSQGKGGRDSRSGSPMARR -> VSSEP (in isoform 2). (191|250)
 
(YGSLP(203)|(204)QKSQH)
203,250

Matrix metalloproteinase-9 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-14 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-25 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-15 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Neutrophil collagenase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-16 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Disintegrin and metalloproteinase domain-containing protein 10 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Merops ADA10_MOUSE -> MBP_MOUSE @203 unknown yes

72 kDa type IV collagenase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Macrophage metalloelastase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Disintegrin and metalloproteinase domain-containing protein 8 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Murphy G Amour A et al.:The enzymatic activity of ADAM8... (M12.210) unknown yes

Matrix metalloproteinase-17 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Targeted features: ?

203,250,250,1 CHAIN - Myelin basic protein. (1|250)
203,250,250,48 VAR_SEQ - EADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNR PHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASG GLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGIL DSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRT QDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR -> LTHENYPLWLPAPEVAARPDPR (in isoform 3). (48|250)
203,250,250,191 VAR_SEQ - DSHTRTTHYGSLPQKSQHGRTQDENPVVHFFKNIVTPRTPP PSQGKGGRDSRSGSPMARR -> VSSEP (in isoform 2). (191|250)

Affected feature boundaries: ?

203,250,205,204 CONFLICT - QK -> HN (in Ref. 15). (204|205)
 
(SLPQK(205)|(206)SQHGR)
205,250

Matrix metalloproteinase-17 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-9 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-14 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-25 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-15 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Neutrophil collagenase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-16 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Macrophage metalloelastase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Targeted features: ?

205,250,250,1 CHAIN - Myelin basic protein. (1|250)
205,250,250,48 VAR_SEQ - EADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNR PHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASG GLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGIL DSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRT QDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR -> LTHENYPLWLPAPEVAARPDPR (in isoform 3). (48|250)
205,250,250,191 VAR_SEQ - DSHTRTTHYGSLPQKSQHGRTQDENPVVHFFKNIVTPRTPP PSQGKGGRDSRSGSPMARR -> VSSEP (in isoform 2). (191|250)

Affected feature boundaries: ?

205,250,205,204 CONFLICT - QK -> HN (in Ref. 15). (204|205)
 
(QKSQH(208)|(209)GRTQD)
208,250

Matrix metalloproteinase-17 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-14 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-25 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Neutrophil collagenase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Matrix metalloproteinase-16 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Macrophage metalloelastase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.006) unknown yes

Targeted features: ?

208,250,250,1 CHAIN - Myelin basic protein. (1|250)
208,250,250,48 VAR_SEQ - EADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNR PHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASG GLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGIL DSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRT QDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR -> LTHENYPLWLPAPEVAARPDPR (in isoform 3). (48|250)
208,250,250,191 VAR_SEQ - DSHTRTTHYGSLPQKSQHGRTQDENPVVHFFKNIVTPRTPP PSQGKGGRDSRSGSPMARR -> VSSEP (in isoform 2). (191|250)

Affected feature boundaries: ?

208,250,211,209 STRAND - (209|211)
 
(RSGSP(246)|(247)MARR)
246,250

Matrix metalloproteinase-25 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Shiryaev SA et al.:Matrix metalloproteinase proteo... (M10.024) unknown none

Targeted features: ?

246,250,250,1 CHAIN - Myelin basic protein. (1|250)
246,250,250,48 VAR_SEQ - EADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNR PHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASG GLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGIL DSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRT QDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR -> LTHENYPLWLPAPEVAARPDPR (in isoform 3). (48|250)
246,250,250,191 VAR_SEQ - DSHTRTTHYGSLPQKSQHGRTQDENPVVHFFKNIVTPRTPP PSQGKGGRDSRSGSPMARR -> VSSEP (in isoform 2). (191|250)

Affected feature boundaries: ?

246,250,245,245 MOD_RES - Phosphoserine; by UHMK1. (245|245)
 
unknown-1MGNHSG...
1,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt80565 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt80566 indirect unknown (unknown)

Affected feature boundaries: ?

1,250,250,1 CHAIN - Myelin basic protein. (1|250)
1,250,133,1 VAR_SEQ - Missing (in isoform 4, isoform 5, isoform 6, isoform 7, isoform 8, isoform 9, isoform 10, isoform 11, isoform 12 and isoform 13). (1|133)
 
unknown-35LSQTAS...
35,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC33055 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34513 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32756 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt137943 indirect unknown (unknown)
 
unknown-76NWQGAH...
76,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC33058 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32864 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32914 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34454 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32694 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32975 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34516 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32759 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt141020 indirect unknown (unknown)
 
unknown-88RPHLIR...
88,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC33207 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32977 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34518 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32761 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt141735 indirect unknown (unknown)
 
unknown-114SDELQT...
114,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC32763 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt143206 indirect unknown (unknown)
 
unknown-117LQTIQE...
117,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC33060 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32866 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32916 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34456 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32696 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC33209 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32979 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34520 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32765 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt143311 indirect unknown (unknown)
 
unknown-120IQEDPT...
120,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC34522 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt143488 indirect unknown (unknown)
 
unknown-127ASGGLD...
127,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC33062 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32698 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC33211 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32767 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt143754 indirect unknown (unknown)
 
unknown-134MASQKR...
134,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from isoform by sequence similarity TopFIND inferred from TNt80567 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt80568 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt80569 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt80570 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt80571 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt80572 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt106106 indirect unknown (unknown)
 
unknown-136SQKRPS...
136,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC33064 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32981 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt144107 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt197480 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt197481 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt197482 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt197483 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt197484 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt197485 indirect unknown (unknown)
 
unknown-137QKRPSQ...
137,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC32769 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC33066 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32983 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt144153 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt197494 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt197495 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt197496 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt197497 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt197498 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt197499 indirect unknown (unknown)
 
unknown-139RPSQRS...
139,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation TISdb inferred from TISdb unknown unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt197528 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt197529 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt197530 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt197531 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt197532 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt197533 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt197534 indirect unknown (unknown)
 
unknown-145KYLATA...
145,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC32771 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC33068 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32918 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34458 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32700 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32985 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34524 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136335 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136336 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136337 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136338 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136340 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136341 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt144513 indirect unknown (unknown)
 
unknown-147LATAST...
147,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC32997 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34536 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136515 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136516 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136517 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136518 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136519 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136520 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt144612 indirect unknown (unknown)
 
unknown-148ATASTM...
148,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC31463 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136550 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136551 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136553 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136554 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136555 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136556 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt144655 indirect unknown (unknown)
 
unknown-150ASTMDH...
150,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC31475 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136675 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136676 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136677 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136678 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136679 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136680 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt144760 indirect unknown (unknown)
 
unknown-151STMDHA...
151,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC32783 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32868 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32930 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34548 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136688 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136689 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136690 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136691 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136692 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt136693 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt144772 indirect unknown (unknown)
 
unknown-159GFLPRH...
159,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC34560 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32795 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC33080 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC33009 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt137224 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt137226 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt137228 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt137231 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt137233 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt137235 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt145086 indirect unknown (unknown)
 
unknown-165RDTGIL...
165,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC34572 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt137663 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt137665 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt137666 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt137667 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt137668 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt137669 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt145329 indirect unknown (unknown)
 
unknown-173IGRFFS...
173,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC32880 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt138334 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt138335 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt138337 indirect unknown (unknown)
 
unknown-176FFSGDR...
176,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC32807 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt138561 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt138562 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt138564 indirect unknown (unknown)
 
unknown-202LPQKSQ...
202,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC34584 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32819 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt140533 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt140534 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt140536 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt142112 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt142114 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt142116 indirect unknown (unknown)
 
unknown-204QKSQHG...
204,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC34595 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32830 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC33092 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32892 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34470 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32942 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC27825 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC33213 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32712 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC27866 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC33021 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt140678 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt140679 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt140697 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt142222 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt142223 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt142235 indirect unknown (unknown)

Affected feature boundaries: ?

204,250,205,204 CONFLICT - QK -> HN (in Ref. 15). (204|205)
 
unknown-206SQHGRT...
206,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC33032 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34606 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32841 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC33103 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32903 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34481 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32953 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32723 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt140806 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt140809 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt140810 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt142316 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt142321 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt142322 indirect unknown (unknown)
 
unknown-209GRTQDE...
209,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC33043 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32852 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC33114 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34492 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32964 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32734 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt141009 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt141010 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt141011 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt142477 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt142479 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt142481 indirect unknown (unknown)

Affected feature boundaries: ?

209,250,211,209 STRAND - (209|211)
 

Protein C-Termini [export]

...RSVGK34-unknown
34,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC33055 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34513 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32756 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt120949 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt120952 indirect unknown (unknown)
 
...ADPKN75-unknown
75,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC33058 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32864 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32914 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34454 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32694 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32975 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34516 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32759 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt124170 indirect unknown (unknown)
 
...ADPGN87-unknown
87,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC33207 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32977 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34518 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32761 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt124917 indirect unknown (unknown)
 
...DRPSE113-unknown
113,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC32763 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt126432 indirect unknown (unknown)
 
...SESDE116-unknown
116,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC33060 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32866 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32916 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34456 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32696 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC33209 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32979 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34520 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32765 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt126541 indirect unknown (unknown)
 
...DELQT119-unknown
119,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC34522 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt126722 indirect unknown (unknown)
 
...EDPTA126-unknown
126,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC33062 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32698 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC33211 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32767 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt126997 indirect unknown (unknown)
 
...LDVMA135-unknown
135,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC33064 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32981 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt127358 indirect unknown (unknown)
 
...DVMAS136-unknown
136,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC32769 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC33066 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32983 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt127405 indirect unknown (unknown)
 
...PSQRS144-unknown
144,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC32771 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC33068 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32918 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34458 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32700 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32985 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34524 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt127778 indirect unknown (unknown)
 
...QRSKY146-unknown
146,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC32997 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34536 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt127879 indirect unknown (unknown)
 
...RSKYL147-unknown
147,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC31463 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt127922 indirect unknown (unknown)
 
...KYLAT149-unknown
149,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC31475 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt128035 indirect unknown (unknown)
 
...YLATA150-unknown
150,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC32783 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32868 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32930 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34548 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt128047 indirect unknown (unknown)
 
...DHARH158-unknown
158,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC34560 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC32795 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC33080 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC33009 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt120141 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt120143 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt120146 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt120149 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt120151 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt120153 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt128367 indirect unknown (unknown)
 
...FLPRH164-unknown
164,250

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC34572 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt120660 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt120662 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt120663 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt120664 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt120665 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt120666 indirect