P32191: GPDM_YEAST (strain ATCC 204508 / S288c) (Baker's yeast)

Protein names
No proteinnames to display
Gene names GUT2
Organism Saccharomyces cerevisiae
Protease Family (Not Available)
Protease ID (Not Available)
Chromosome IX

Sequence

        10         20         30         40         50         60 
MFSVTRRRAA GAAAAMATAT GTLYWMTSQG DRPLVHNDPS YMVQFPTAAP PQVSRRDLLD 
        70         80         90        100        110        120 
RLAKTHQFDV LIIGGGATGT GCALDAATRG LNVALVEKGD FASGTSSKST KMIHGGVRYL 
       130        140        150        160        170        180 
EKAFWEFSKA QLDLVIEALN ERKHLINTAP HLCTVLPILI PIYSTWQVPY IYMGCKFYDF 
       190        200        210        220        230        240 
FAGSQNLKKS YLLSKSATVE KAPMLTTDNL KASLVYHDGS FNDSRLNATL AITAVENGAT 
       250        260        270        280        290        300 
VLNYVEVQKL IKDPTSGKVI GAEARDVETN ELVRINAKCV VNATGPYSDA ILQMDRNPSG 
       310        320        330        340        350        360 
LPDSPLNDNS KIKSTFNQIA VMDPKMVIPS IGVHIVLPSF YCPKDMGLLD VRTSDGRVMF 
       370        380        390        400        410        420 
FLPWQGKVLA GTTDIPLKQV PENPMPTEAD IQDILKELQH YIEFPVKRED VLSAWAGVRP 
       430        440        450        460        470        480 
LVRDPRTIPA DGKKGSATQG VVRSHFLFTS DNGLITIAGG KWTTYRQMAE ETVDKVVEVG 
       490        500        510        520        530        540 
GFHNLKPCHT RDIKLAGAEE WTQNYVALLA QNYHLSSKMS NYLVQNYGTR SSIICEFFKE 
       550        560        570        580        590        600 
SMENKLPLSL ADKENNVIYS SEENNLVNFD TFRYPFTIGE LKYSMQYEYC RTPLDFLLRR 
       610        620        630        640    
TRFAFLDAKE ALNAVHATVK VMGDEFNWSE KKRQWELEKT VNFIKTFGV

Annotation ?

Network neighborhood
[show protein-protein interactions]
 
100
200
300
400
500
600
Chains:

 
 
N-termini:

N
NNN
N
 
C-termini:
C
 
Features:
 
 
Binding & active sites:
 
 
Sequence variations:
         
 
unknown-0VMFSVT...
0,649

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

0,649,649,0 CHAIN - Glycerol-3-phosphate dehydrogenase, mitochondrial. (0|649)
 
unknown-1MFSVTR...
1,649

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
Voegtle FN. et al.: Global Analysis of the Mitochondrial N-Proteome... unknown unknown (unknown)

Affected feature boundaries: ?

1,649,51,1 CONFLICT - MFSVTRRRAAGAAAAMATATGTLYWMTSQGDRPLVHNDPSY MVQFPTAAPP -> MTRATWCNSPPPLHR (in Ref. 1). (1|51)
1,649,0,1 TRANSIT - Mitochondrion (Potential). (1|0)
 
unknown-38DPSYMV...
38,649

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
Voegtle FN. et al.: Global Analysis of the Mitochondrial N-Proteome... unknown unknown (unknown)
 
unknown-44QFPTAA...
44,649

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
Voegtle FN. et al.: Global Analysis of the Mitochondrial N-Proteome... unknown unknown (unknown)
 
unknown-49APPQVS...
49,649

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
Voegtle FN. et al.: Global Analysis of the Mitochondrial N-Proteome... unknown unknown (unknown)
 

Protein C-Termini [export]

...KTFGV649-unknown
649,649

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

649,649,649,0 CHAIN - Glycerol-3-phosphate dehydrogenase, mitochondrial. (0|649)
 
Filter by evidence: ?

Directness ?

  • unknown

Physiological relevance ?

  • unknown

Evidencecode ?

Method ?

Perturbation ?

Confidence greater than?

  • unknown

Experimental system ?

Certainty of Protease assignment ?

  • unknown

Evidencecode ?

Tissue distribution ?

Specific evidence ?

Derived from database?

Laboratory ?