P35183: Protein AST1 (strain ATCC 204508 / S288c) (Baker's yeast)

Protein names
  • Protein AST1
  • AST1
Gene names AST1
Organism Saccharomyces cerevisiae
Protease Family (Not Available)
Protease ID (Not Available)
Chromosome II

Sequence

        10         20         30         40         50         60 
MAKDILKNQD PKLQAMIVEH SAPAPKEIPM DAPVLKRVAR PLRHVKFIPI KSLIFHTKTG 
        70         80         90        100        110        120 
PMDFSYEKKI KTPIPKNKIV VRVSNVGLNP VDMKIRNGYT SSIYGEIGLG REYSGVITEV 
       130        140        150        160        170        180 
GENLNYAWHV GDEVYGIYYH PHLAVGCLQS SILVDPKVDP ILLRPESVSA EEAAGSLFCL 
       190        200        210        220        230        240 
ATGYNILNKL SKNKYLKQDS NVLINGGTSS VGMFVIQLLK RHYKLQKKLV IVTSANGPQV 
       250        260        270        280        290        300 
LQEKFPDLAD EMIFIDYLTC RGKSSKPLRK MLEEKKISQY DPVEDKETIL NYNEGKFDVV 
       310        320        330        340        350        360 
LDFVGGYDIL SHSSSLIHGG GAYVTTVGDY VANYKEDIFD SWDNPSANAR KMFGSIIWSY 
       370        380        390        400        410        420 
NYTHYYFDPN AKTASANNDW IEQCGDFLKN GTVKCVVDKV YDWKDHKEAF SYMATQRAQG 
   
KLIMNVEKF

Annotation ?

Network neighborhood
[show protein-protein interactions]
 
100
200
300
400
Chains:
 
 
N-termini:

N
 
C-termini:
C
 
Sequence variations:
 
 
unknown-1MAKDIL...
1,429

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

1,429,429,1 CHAIN - Protein AST1. (1|429)
 

Protein C-Termini [export]

...NVEKF429-unknown
429,429

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

429,429,429,326 CONFLICT - TVGDYVANYKEDIFDSWDNPSANARKMFGSIIWSYNYTHYY FDPNAKTASANNDWIEQCGDFLKNGTVKCVVDKVYDWKDHK EAFSYMATQRAQGKLIMNVEKF -> HCR (in Ref. 2). (326|429)
429,429,429,1 CHAIN - Protein AST1. (1|429)
 
Filter by evidence: ?

Directness ?

  • unknown

Physiological relevance ?

  • unknown

Evidencecode ?

Method ?

Perturbation ?

Confidence greater than?

  • unknown

Experimental system ?

Certainty of Protease assignment ?

  • unknown

Evidencecode ?

Tissue distribution ?

Specific evidence ?

Derived from database?

Laboratory ?