P48349: 14-3-3-like protein GF14 lambda (Mouse-ear cress)

Protein names
  • 14-3-3-like protein GF14 lambda
  • 14-3-3-like protein AFT1
  • 14-3-3-like protein RCI2
  • General regulatory factor 6;
  • 14336
Gene names GRF6 (AFT1, RCI2)
Organism Arabidopsis thaliana
Protease Family (Not Available)
Protease ID (Not Available)
Chromosome 5


  • Isoform 2 of 14-3-3-like protein GF14 lambda (P48349-2): sequence view | extended view


        10         20         30         40         50         60 
        70         80         90        100        110        120 
       130        140        150        160        170        180 
       190        200        210        220        230        240 

Annotation ?

Network neighborhood
[show protein-protein interactions]

Sequence variations:

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt65716 indirect unknown (unknown)

Affected feature boundaries: ?

1,248,248,1 CHAIN - 14-3-3-like protein GF14 lambda. (1|248)

Protein C-Termini [export]


Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

248,248,248,1 CHAIN - 14-3-3-like protein GF14 lambda. (1|248)
248,248,248,241 CONFLICT - MQEQMDEA -> YAGADGRGLRI (in Ref. 1; CAA52238). (241|248)
248,248,248,243 VAR_SEQ - EQMDEA -> TNQMHHIRDIKEHVKTEITAKPCVLSYYYSM (in isoform 2). (243|248)
Filter by evidence: ?

Directness ?

  • unknown
  • indirect

Physiological relevance ?

  • unknown

Evidencecode ?

Method ?

Perturbation ?

Confidence greater than?

  • unknown

Experimental system ?

Certainty of Protease assignment ?

  • unknown

Evidencecode ?

Tissue distribution ?

Specific evidence ?

Derived from database?

Laboratory ?