P51790: H(+)/Cl(-) exchange transporter 3 (Human)

Protein names
  • H(+)/Cl(-) exchange transporter 3
  • Chloride channel protein 3 Short=ClC-3
  • Chloride transporter ClC-3
  • CLCN3
Gene names CLCN3
Organism Homo sapiens
Protease Family (Not Available)
Protease ID (Not Available)
Chromosome 4

Isoforms

  • Isoform 2 of H(+)/Cl(-) exchange transporter 3 (P51790-2): sequence view | extended view
  • Isoform 3 of H(+)/Cl(-) exchange transporter 3 (P51790-4): sequence view | extended view
  • Isoform 4 of H(+)/Cl(-) exchange transporter 3 (P51790-5): sequence view | extended view

Sequence

        10         20         30         40         50         60 
MESEQLFHRG YYRNSYNSIT SASSDEELLD GAGVIMDFQT SEDDNLLDGD TAVGTHYTMT 
        70         80         90        100        110        120 
NGGSINSSTH LLDLLDEPIP GVGTYDDFHT IDWVREKCKD RERHRRINSK KKESAWEMTK 
       130        140        150        160        170        180 
SLYDAWSGWL VVTLTGLASG ALAGLIDIAA DWMTDLKEGI CLSALWYNHE QCCWGSNETT 
       190        200        210        220        230        240 
FEERDKCPQW KTWAELIIGQ AEGPGSYIMN YIMYIFWALS FAFLAVSLVK VFAPYACGSG 
       250        260        270        280        290        300 
IPEIKTILSG FIIRGYLGKW TLMIKTITLV LAVASGLSLG KEGPLVHVAC CCGNIFSYLF 
       310        320        330        340        350        360 
PKYSTNEAKK REVLSAASAA GVSVAFGAPI GGVLFSLEEV SYYFPLKTLW RSFFAALVAA 
       370        380        390        400        410        420 
FVLRSINPFG NSRLVLFYVE YHTPWYLFEL FPFILLGVFG GLWGAFFIRA NIAWCRRRKS 
       430        440        450        460        470        480 
TKFGKYPVLE VIIVAAITAV IAFPNPYTRL NTSELIKELF TDCGPLESSS LCDYRNDMNA 
       490        500        510        520        530        540 
SKIVDDIPDR PAGIGVYSAI WQLCLALIFK IIMTVFTFGI KVPSGLFIPS MAIGAIAGRI 
       550        560        570        580        590        600 
VGIAVEQLAY YHHDWFIFKE WCEVGADCIT PGLYAMVGAA ACLGGVTRMT VSLVVIVFEL 
       610        620        630        640        650        660 
TGGLEYIVPL MAAVMTSKWV GDAFGREGIY EAHIRLNGYP FLDAKEEFTH TTLAADVMRP 
       670        680        690        700        710        720 
RRNDPPLAVL TQDNMTVDDI ENMINETSYN GFPVIMSKES QRLVGFALRR DLTIAIESAR 
       730        740        750        760        770        780 
KKQEGIVGSS RVCFAQHTPS LPAESPRPLK LRSILDMSPF TVTDHTPMEI VVDIFRKLGL 
       790        800        810    
RQCLVTHNGR LLGIITKKDI LRHMAQTANQ DPASIMFN

Annotation ?

Network neighborhood
[show protein-protein interactions]
 
100
200
300
400
500
600
700
800
Chains:
 
 
N-termini:

N
 
C-termini:
CCCCC
 
Features:
  
     
 
Binding & active sites:
     
 
Sequence variations:
         
 
unknown-1MESEQL...
1,818

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt70924 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt70925 indirect unknown (unknown)

Affected feature boundaries: ?

1,818,53,1 VAR_SEQ - MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTS EDDNLLDGDTAV -> MVTLQLGESHYVVQAGLQLLGSSNP PALASQVAEIT (in isoform 4). (1|53)
1,818,125,1 TOPO_DOM - Cytoplasmic (By similarity). (1|125)
1,818,818,1 CHAIN - H(+)/Cl(-) exchange transporter 3. (1|818)
 

Protein C-Termini [export]

...LTGLA138-unknown
138,818

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation Ensembl inferred from ensembl protein ENSP00000425823 unknown unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt154820 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt154821 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt154822 indirect unknown (unknown)
 
...HEQCC173-unknown
173,818

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation Ensembl inferred from ensembl protein ENSP00000425160 unknown unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt155306 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt155307 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt155308 indirect unknown (unknown)
 
...VTRMT590-unknown
590,818

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation Ensembl inferred from ensembl protein ENSP00000422678 unknown unknown (unknown)
 
...PLKLR752-unknown
752,818

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation Ensembl inferred from ensembl protein ENSP00000425323 unknown unknown (unknown)
 
...SIMFN818-unknown
818,818

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt66543 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt66544 indirect unknown (unknown)

Affected feature boundaries: ?

818,818,818,790 VAR_SEQ - RLLGIITKKDILRHMAQTANQDPASIMFN -> IVLGIITK KNILEHLEQLKQHVEPLAPPWHYNKKRYPPAYGPDGKPRPR FNNVQLNLTDEEREETEEEVYLLNSTTL (in isoform 2). (790|818)
818,818,818,625 TOPO_DOM - Cytoplasmic (By similarity). (625|818)
818,818,818,1 CHAIN - H(+)/Cl(-) exchange transporter 3. (1|818)
 
Filter by evidence: ?

Directness ?

  • unknown
  • indirect

Physiological relevance ?

  • unknown

Evidencecode ?

Method ?

Perturbation ?

Confidence greater than?

  • unknown

Experimental system ?

Certainty of Protease assignment ?

  • unknown

Evidencecode ?

Tissue distribution ?

Specific evidence ?

Derived from database?

Laboratory ?