P51797: Chloride transport protein 6 (Human)

Protein names
  • Chloride transport protein 6
  • Chloride channel protein 6 Short=ClC-6
  • CLCN6
Gene names CLCN6 (KIAA0046)
Organism Homo sapiens
Protease Family (Not Available)
Protease ID (Not Available)
Chromosome 1

Isoforms

  • Isoform 2 of Chloride transport protein 6 (P51797-2): sequence view | extended view
  • Isoform 3 of Chloride transport protein 6 (P51797-3): sequence view | extended view
  • Isoform 4 of Chloride transport protein 6 (P51797-4): sequence view | extended view
  • Isoform 5 of Chloride transport protein 6 (P51797-5): sequence view | extended view
  • Isoform 6 of Chloride transport protein 6 (P51797-6): sequence view | extended view

Sequence

        10         20         30         40         50         60 
MAGCRGSLCC CCRWCCCCGE RETRTPEELT ILGETQEEED EILPRKDYES LDYDRCINDP 
        70         80         90        100        110        120 
YLEVLETMDN KKGRRYEAVK WMVVFAIGVC TGLVGLFVDF FVRLFTQLKF GVVQTSVEEC 
       130        140        150        160        170        180 
SQKGCLALSL LELLGFNLTF VFLASLLVLI EPVAAGSGIP EVKCYLNGVK VPGIVRLRTL 
       190        200        210        220        230        240 
LCKVLGVLFS VAGGLFVEKE GPMIHSGSVV GAGLPQFQSI SLRKIQFNFP YFRSDRDKRD 
       250        260        270        280        290        300 
FVSAGAAAGV AAAFGAPIGG TLFSLEEGSS FWNQGLTWKV LFCSMSATFT LNFFRSGIQF 
       310        320        330        340        350        360 
GSWGSFQLPG LLNFGEFKCS DSDKKCHLWT AMDLGFFVVM GVIGGLLGAT FNCLNKRLAK 
       370        380        390        400        410        420 
YRMRNVHPKP KLVRVLESLL VSLVTTVVVF VASMVLGECR QMSSSSQIGN DSFQLQVTED 
       430        440        450        460        470        480 
VNSSIKTFFC PNDTYNDMAT LFFNPQESAI LQLFHQDGTF SPVTLALFFV LYFLLACWTY 
       490        500        510        520        530        540 
GISVPSGLFV PSLLCGAAFG RLVANVLKSY IGLGHIYSGT FALIGAAAFL GGVVRMTISL 
       550        560        570        580        590        600 
TVILIESTNE ITYGLPIMVT LMVAKWTGDF FNKGIYDIHV GLRGVPLLEW ETEVEMDKLR 
       610        620        630        640        650        660 
ASDIMEPNLT YVYPHTRIQS LVSILRTTVH HAFPVVTENR GNEKEFMKGN QLISNNIKFK 
       670        680        690        700        710        720 
KSSILTRAGE QRKRSQSMKS YPSSELRNMC DEHIASEEPA EKEDLLQQML ERRYTPYPNL 
       730        740        750        760        770        780 
YPDQSPSEDW TMEERFRPLT FHGLILRSQL VTLLVRGVCY SESQSSASQP RLSYAEMAED 
       790        800        810        820        830        840 
YPRYPDIHDL DLTLLNPRMI VDVTPYMNPS PFTVSPNTHV SQVFNLFRTM GLRHLPVVNA 
       850        860    
VGEIVGIITR HNLTYEFLQA RLRQHYQTI

Annotation ?

Network neighborhood
[show protein-protein interactions]
 
100
200
300
400
500
600
700
800
Chains:
 
 
N-termini:

N
 
C-termini:
C
 
Features:
  
     
 
Binding & active sites:
     
 
Sequence variations:
     
  
 
 
 
     
 
unknown-1MAGCRG...
1,869

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt70930 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt70931 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt70932 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt70933 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt70934 indirect unknown (unknown)

Affected feature boundaries: ?

1,869,80,1 TOPO_DOM - Cytoplasmic (By similarity). (1|80)
1,869,869,1 CHAIN - Chloride transport protein 6. (1|869)
 

Protein C-Termini [export]

...HYQTI869-unknown
869,869

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt66552 indirect unknown (unknown)

Affected feature boundaries: ?

869,869,869,309 VAR_SEQ - Missing (in isoform 4). (309|869)
869,869,869,321 VAR_SEQ - Missing (in isoform 2). (321|869)
869,869,869,354 VAR_SEQ - Missing (in isoform 3). (354|869)
869,869,869,844 VAR_SEQ - IVGIITRHNLTYEFLQARLRQHYQTI -> VSEAPALPPPL REDPLARCCLCTQASHQKRRHPTRRGECGPTLALNPARLPC TRDPFPCLPADGTSVPLAVLSSQSRASTRLCLPPEMLLFTP YHWCSLVLHLRRDLRIR (in isoform 5). (844|869)
869,869,869,572 TOPO_DOM - Cytoplasmic (By similarity). (572|869)
869,869,869,1 CHAIN - Chloride transport protein 6. (1|869)
 
Filter by evidence: ?

Directness ?

  • unknown
  • indirect

Physiological relevance ?

  • unknown

Evidencecode ?

Method ?

Perturbation ?

Confidence greater than?

  • unknown

Experimental system ?

Certainty of Protease assignment ?

  • unknown

Evidencecode ?

Tissue distribution ?

Specific evidence ?

Derived from database?

Laboratory ?