P54964: ORN (strain ATCC 204508 / S288c) (Baker's yeast)

Protein names
  • ORN
Gene names REX2 (YNT20)
Organism Saccharomyces cerevisiae
Protease Family (Not Available)
Protease ID (Not Available)
Chromosome XII

Sequence

        10         20         30         40         50         60 
MKWLLFPARI VARTRPNLFS LYRRSVSQYL RPRTIQNLQS MAQTPELKTK LFKPLVWIDC 
        70         80         90        100        110        120 
EMTGLDHVND RIIEICCIIT DGHLAPVKAA DGQGDSHYES VIHYGPEVMN KMNEWCIEHH 
       130        140        150        160        170        180 
GNSGLTAKVL ASEKTLAQVE DELLEYIQRY IPDKNVGVLA GNSVHMDRLF MVREFPKVID 
       190        200        210        220        230        240 
HLFYRIVDVS SIMEVARRHN PALQARNPKK EAAHTAYSDI KESIAQLQWY MDNYLKPPQE 
       250        260    
TESVESIGSE QPESPSSSTS SLKRQRTDF

Annotation ?

Network neighborhood
[show protein-protein interactions]
 
100
200
Chains:

 
 
N-termini:

NN
 
C-termini:
C
 
Features:
  
 
Binding & active sites:
 
 
Sequence variations:
    
 
unknown-0FMKWLL...
0,269

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

0,269,269,0 CHAIN - Oligoribonuclease, mitochondrial. (0|269)
 
unknown-26VSQYLR...
26,269

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
Voegtle FN. et al.: Global Analysis of the Mitochondrial N-Proteome... unknown unknown (unknown)
 

Protein C-Termini [export]

...QRTDF269-unknown
269,269

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

269,269,269,223 CONFLICT - SIAQLQWYMDNYLKPPQETESVESIGSEQPESPSSSTSSLK RQRTDF -> HSSIAMVHGQLLEATTGNRVGRVNRI (in Ref. 1). (223|269)
269,269,269,0 CHAIN - Oligoribonuclease, mitochondrial. (0|269)
 
Filter by evidence: ?

Directness ?

  • unknown

Physiological relevance ?

  • unknown

Evidencecode ?

Method ?

Perturbation ?

Confidence greater than?

  • unknown

Experimental system ?

Certainty of Protease assignment ?

  • unknown

Evidencecode ?

Tissue distribution ?

Specific evidence ?

Derived from database?

Laboratory ?