P56546: C-terminal-binding protein 2 (Mouse)

Protein names
  • C-terminal-binding protein 2 (CtBP2)
  • CTBP2
Gene names Ctbp2
Organism Mus musculus
Protease Family (Not Available)
Protease ID (Not Available)
Chromosome 7

Isoforms

  • Isoform 2 of C-terminal-binding protein 2 (P56546-2): sequence view | extended view

Sequence

        10         20         30         40         50         60 
MALVDKHKVK RQRLDRICEG IRPQIMNGPL HPRPLVALLD GRDCTVEMPI LKDLATVAFC 
        70         80         90        100        110        120 
DAQSTQEIHE KVLNEAVGAM MYHTITLTRE DLEKFKALRV IVRIGSGYDN VDIKAAGELG 
       130        140        150        160        170        180 
IAVCNIPSAA VEETADSTVC HILNLYRRNT WLYQALREGT RVQSVEQIRE VASGAARIRG 
       190        200        210        220        230        240 
ETLGLIGFGR TGQAVAVRAK AFGFSVIFYD PYLQDGIERS LGVQRVYTLQ DLLYQSDCVS 
       250        260        270        280        290        300 
LHCNLNEHNH HLINDFTIKQ MRQGAFLVNA ARGGLVDEKA LAQALKEGRI RGAALDVHES 
       310        320        330        340        350        360 
EPFSFAQGPL KDAPNLICTP HTAWYSEQAS LEMREAAATE IRRAITGRIP ESLRNCVNKE 
       370        380        390        400        410        420 
FFVTSAPWSV IDQQAIHPEL NGATYRYPPG IVGVAPGGLP PAMEGIIPGG IPVTHNLPTV 
       430        440    
AHPSQAPSPN QPTKHGDNRE HPNEQ

Annotation ?

Network neighborhood
[show protein-protein interactions]
 
100
200
300
400
Chains:
 
 
N-termini:

NN
 
C-termini:
CC
 
Cleavage sites:
 
 
 
Binding & active sites:
     
    
 
 
Sequence variations:
    
 
Modifications:
 
 
(LHPRP(34)|(35)LVALL)
34,445

Matrix metalloproteinase-9 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Overall CM Prudova A et al.:Multiplex N-terminome analysis ... (M10.004) unknown none

72 kDa type IV collagenase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Overall CM Prudova A et al.:Multiplex N-terminome analysis ... (M10.004) unknown none

Targeted features: ?

34,445,445,1 CHAIN - C-terminal-binding protein 2. (1|445)
 
unknown-1MALVDK...
1,445

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

1,445,445,1 CHAIN - C-terminal-binding protein 2. (1|445)
1,445,20,1 VAR_SEQ - MALVDKHKVKRQRLDRICEG -> MPVPSRHINIGRSQSWD AAGWYEGPWENAGPPGRRSSLTYGPGEGTWCELLNHRAQDT ESYLSREAFYNSLASRKGSVPDFTFYDSRQAVMSGRGSVLP QDYYGDPSRGTRVPKEPPFYRDPGTSRPVPSYGMLGSRMPW EQVQGQLPALQDTGHLYPESGGKTVPHGQRTHGRAPSPGRY GREQPDTRLGIEVPTYSPNSSQVYNDICERPVDSTPARQVA PTC (1|20)
 
unknown-35LVALLD...
35,445

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC34628 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC33633 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt154303 indirect unknown (unknown)
 

Protein C-Termini [export]

...LHPRP34-unknown
34,445

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC34628 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC33633 indirect unknown (unknown)
 
...HPNEQ445-unknown
445,445

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt67596 indirect unknown (unknown)

Affected feature boundaries: ?

445,445,445,1 CHAIN - C-terminal-binding protein 2. (1|445)
 
Filter by evidence: ?

Directness ?

  • unknown
  • indirect

Physiological relevance ?

  • none
  • unknown

Evidencecode ?

Method ?

Perturbation ?

Confidence greater than?

  • unknown

Experimental system ?

Certainty of Protease assignment ?

  • unknown

Evidencecode ?

Tissue distribution ?

Specific evidence ?

Derived from database?

Laboratory ?