P63104: 14-3-3 protein zeta/delta (Human)

Protein names
  • 14-3-3 protein zeta/delta
  • Protein kinase C inhibitor protein 1 Short=KCIP-1
  • 1433Z
Gene names YWHAZ
Organism Homo sapiens
Protease Family (Not Available)
Protease ID (Not Available)
Chromosome 8

Isoforms

  • Isoform 2 of 14-3-3 protein zeta/delta (P63104-2): sequence view | extended view

Sequence

        10         20         30         40         50         60 
MDKNELVQKA KLAEQAERYD DMAACMKSVT EQGAELSNEE RNLLSVAYKN VVGARRSSWR 
        70         80         90        100        110        120 
VVSSIEQKTE GAEKKQQMAR EYREKIETEL RDICNDVLSL LEKFLIPNAS QAESKVFYLK 
       130        140        150        160        170        180 
MKGDYYRYLA EVAAGDDKKG IVDQSQQAYQ EAFEISKKEM QPTHPIRLGL ALNFSVFYYE 
       190        200        210        220        230        240 
ILNSPEKACS LAKTAFDEAI AELDTLSEES YKDSTLIMQL LRDNLTLWTS DTQGDEAEAG 
   
EGGEN

Annotation ?

Network neighborhood
[show protein-protein interactions]
 
100
200
Chains:
 
 
N-termini:

N
NN
NN
N
N
N
N
NN
NN
NN
 
C-termini:
CC
CC
CCC
C
 
Cleavage sites:
      
 
Features:
  
 
Sequence variations:
 
   
   
 
Modifications:
       
 
(MKSVT(30)|(31)EQGAE)
30,245

Cathepsin L1 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Schilling O Biniossek ML et al.:Proteomic identification of pro... (C01.060) unknown none

Targeted features: ?

30,245,98,1 VAR_SEQ - MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEER NLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREY REKIETELRDICNDVL -> MSQPCRKLWRHNYETSSCIEF LK (in isoform 2). (1|98)
30,245,245,1 CHAIN - 14-3-3 protein zeta/delta. (1|245)
 
(QSQQA(148)|(149)YQEAF)
148,245

Meprin A subunit beta (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Overall CM Becker-Pauly C et al.:Proteomic analyses reveal an ac... (M12.002) unknown none

Targeted features: ?

148,245,245,1 CHAIN - 14-3-3 protein zeta/delta. (1|245)
148,245,159,135 HELIX - (135|159)
 
(QQAYQ(150)|(151)EAFEI)
150,245

Cathepsin L1 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Schilling O Biniossek ML et al.:Proteomic identification of pro... (C01.060) unknown none

Targeted features: ?

150,245,245,1 CHAIN - 14-3-3 protein zeta/delta. (1|245)
150,245,159,135 HELIX - (135|159)
 
(IAELD(204)|(205)TLSEE)
204,245

Caspase-6 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Leblanc AC Klaiman G et al.:Targets of caspase-6 activity i... (C14.005) unknown yes

Targeted features: ?

204,245,245,1 CHAIN - 14-3-3 protein zeta/delta. (1|245)
 
(LDTLS(207)|(208)EESYK)
207,245

Meprin A subunit beta (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Overall CM Becker-Pauly C et al.:Proteomic analyses reveal an ac... (M12.002) unknown none

Targeted features: ?

207,245,245,1 CHAIN - 14-3-3 protein zeta/delta. (1|245)

Affected feature boundaries: ?

207,245,207,207 MOD_RES - Phosphoserine. (207|207)
207,245,210,208 TURN - (208|210)
207,245,207,207 MOD_RES - Phosphoserine. (207|207)
 
(DTQGD(235)|(236)EAEAG)
235,245

Caspase-6 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Leblanc AC Klaiman G et al.:Targets of caspase-6 activity i... (C14.005) unknown yes

Targeted features: ?

235,245,245,1 CHAIN - 14-3-3 protein zeta/delta. (1|245)
 
acetylation-1MDKNEL...
1,245

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
Gevaert K. Van Damme P et al.: Complementary positional proteomics for screening substrates... direct yes 0.0 (unknown)
CNRS/ISV Large_scale_NTA_Human direct yes 0.0 (MASCOT score)
Gevaert K. Van Damme P et al.: PC3-cells, Complementary positional proteomics for screening substrates... direct yes 0.0 (unknown)
Overall Laboratory Lange_Huesgen_et_al-RBC direct yes 0.88 (PeptideProphet probability)

Affected feature boundaries: ?

1,245,98,1 VAR_SEQ - MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEER NLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREY REKIETELRDICNDVL -> MSQPCRKLWRHNYETSSCIEF LK (in isoform 2). (1|98)
1,245,1,1 MOD_RES - N-acetylmethionine. (1|1)
1,245,245,1 CHAIN - 14-3-3 protein zeta/delta. (1|245)
 
unknown-2DKNELV...
2,245

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
Gevaert K. Van Damme P et al.: PC3-cells, Complementary positional proteomics for screening substrates... direct yes 0.0 (unknown)
 
unknown-28SVTEQG...
28,245

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
Wells apoptotic_Jurkat_bortezomib direct yes 0.02 (ProteinProspector)
Wells apoptotic_Jurkat_staurotrail direct yes 0.02 (ProteinProspector)
Wells apoptotic_MM1s_bort direct yes 0.02 (ProteinProspector)
Wells MM1SDBJurkat_Untreated direct yes 0.02 (ProteinProspector)
Wells apoptotic_MM1SDBJurkat_Mix direct yes 0.02 (ProteinProspector)
Wells apoptosis_U266_bortezomib_induced direct yes 0.02 (ProteinProspector)
Overall Laboratory Lange_Huesgen_et_al-RBC direct yes 0.88 (PeptideProphet probability)
 
unknown-31EQGAEL...
31,245

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC6145 indirect unknown (unknown)
 
unknown-145SQQAYQ...
145,245

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from isoform by sequence similarity TopFIND inferred from TNt166824 indirect unknown (unknown)
 
unknown-145SQQAYQ...
145,245

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
Wells apoptotic_Jurkat_bortezomib direct yes 0.02 (ProteinProspector)
Wells apoptotic_Jurkat_staurotrail direct yes 0.02 (ProteinProspector)
Wells apoptotic_MM1s_bort direct yes 0.02 (ProteinProspector)
Wells MM1SDBJurkat_Untreated direct yes 0.02 (ProteinProspector)
Wells apoptosis_U266_bortezomib_induced direct yes 0.02 (ProteinProspector)
 
unknown-148AYQEAF...
148,245

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
Wells apoptotic_Jurkat_staurotrail direct yes 0.02 (ProteinProspector)
 
unknown-148AYQEAF...
148,245

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from isoform by sequence similarity TopFIND inferred from TNt173178 indirect unknown (unknown)
 
unknown-149YQEAFE...
149,245

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC19274 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt140881 indirect unknown (unknown)
 
unknown-151EAFEIS...
151,245

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC6146 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt141004 indirect unknown (unknown)
 
unknown-199AIAELD...
199,245

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from isoform by sequence similarity TopFIND inferred from TNt170453 indirect unknown (unknown)
 
unknown-199AIAELD...
199,245

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
Wells apoptotic_Jurkat_staurotrail direct yes 0.02 (ProteinProspector)
Wells apoptotic_MM1s_bort direct yes 0.02 (ProteinProspector)
 
unknown-205TLSEES...
205,245

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC2610 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt143886 indirect unknown (unknown)
 
unknown-208EESYKD...
208,245

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC19276 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt143999 indirect unknown (unknown)

Affected feature boundaries: ?

208,245,210,208 TURN - (208|210)
 
unknown-236EAEAGE...
236,245

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC2612 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt145176 indirect unknown (unknown)
 

Protein C-Termini [export]

...MKSVT30-unknown
30,245

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC6145 indirect unknown (unknown)
 
...QSQQA148-unknown
148,245

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC19274 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt124022 indirect unknown (unknown)
 
...QQAYQ150-unknown
150,245

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC6146 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt124154 indirect unknown (unknown)
 
...IAELD204-unknown
204,245

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC2610 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt127130 indirect unknown (unknown)
 
...LDTLS207-unknown
207,245

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC19276 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt127242 indirect unknown (unknown)

Affected feature boundaries: ?

207,245,207,207 MOD_RES - Phosphoserine. (207|207)
 
...DTQGD235-unknown
235,245

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC2612 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt128464 indirect unknown (unknown)
 
...EGGEN245-unknown
245,245

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt61341 indirect unknown (unknown)
Gevaert K. Van Damme P et al.: PC3-cells, Complementary positional proteomics for screening substrates... direct yes 0.0 (unknown)

Affected feature boundaries: ?

245,245,245,1 CHAIN - 14-3-3 protein zeta/delta. (1|245)
 
...EGGEN245-unknown
245,245

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
Gevaert K. Van Damme P et al.: PC3-cells, Complementary positional proteomics for screening substrates... direct yes 0.0 (unknown)

Affected feature boundaries: ?

245,245,245,1 CHAIN - 14-3-3 protein zeta/delta. (1|245)
 
Filter by evidence: ?

Directness ?

  • unknown
  • direct
  • indirect

Physiological relevance ?

  • none
  • yes
  • unknown

Evidencecode ?

Method ?

Perturbation ?

Confidence greater than?

  • unknown
  • MASCOT score
  • PeptideProphet probability
  • ProteinProspector

Experimental system ?

Certainty of Protease assignment ?

  • unknown
  • III proteolytic system present but impaired
  • IV proteolytic system present and active

Evidencecode ?

Tissue distribution ?

Specific evidence ?

Derived from database?

Laboratory ?