P70232: Neural cell adhesion molecule L1-like protein (Mouse)

Protein names
  • Neural cell adhesion molecule L1-like protein
  • Cell adhesion molecule with homology to L1CAM
  • Chl1-like protein
  • Close homolog of L1
  • CHL1
Gene names Chl1 (Call)
Organism Mus musculus
Protease Family (Not Available)
Protease ID (Not Available)
Chromosome 6

Isoforms

  • Isoform 2 of Neural cell adhesion molecule L1-like protein (P70232-2): sequence view | extended view

Sequence

        10         20         30         40         50         60 
MMELPLCGRG LILSLIFLLL KLSAAEIPLS VQQVPTIVKQ SYVQVAFPFD EYFQIECEAK 
        70         80         90        100        110        120 
GNPEPIFSWT KDDKPFDLSD PRIIAANNSG TFKIPNEGHI SHFQGKYRCF ASNRLGTAVS 
       130        140        150        160        170        180 
EEIEFIVPGV PKFPKEKIEP IDVEEGDSIV LPCNPPKGLP PLHIYWMNIE LEHIEQDERV 
       190        200        210        220        230        240 
YMSQRGDLYF ANVEENDSRN DYCCFAAFPK LRTIVQKMPM KLTVNSSNSI KQRKPKLLLP 
       250        260        270        280        290        300 
PAQMGSLSAK TVLKGDTLLL ECFAEGLPTP HIQWSKPGSE LPEGRATIEV HEKTLKIENI 
       310        320        330        340        350        360 
SYQDRGNYRC TANNLLGKAS HDFHVTVEEP PRWKKKPQSA VYSTGSSGIL LCEAEGEPQP 
       370        380        390        400        410        420 
TIKWRLNGLP IEKHPFPGDF MFPREISFTN LLPNHTGVYQ CEASNIHGTI LANANIDVID 
       430        440        450        460        470        480 
VIPLIKTKNE ENYATVVGYS AFLHCEYFAS PKATVVWEVA DETHPLEGDR YHTHENGTLE 
       490        500        510        520        530        540 
IYRTTEEDAG SYSCWVDNAM GKAVITANLD IRNATKLRVS PKNPRIPKSH VLELYCESQC 
       550        560        570        580        590        600 
DSHLKHSLKL SWSKDGEAFE MNGTEDGRIV IDGAYLTISN ITAEDQGVYS CSAQTSLDST 
       610        620        630        640        650        660 
SEKTQVTVLG VPDPPGNLHL SERQNRSVRL SWEAGDDHNS KISEYIVEFE GNREEPGKWE 
       670        680        690        700        710        720 
ELTRVQGEET DVVLSLAPYV RYQFRVTAVN EVGRSHASLP SDHHETPPAA PDKNPQNIRV 
       730        740        750        760        770        780 
QASQPKEMII KWEPLKSMEQ NGPGLEYKVS WKPQGAPEEW EEEIVTNHTL RVMTPTVYAP 
       790        800        810        820        830        840 
YDVKVQAINQ LGSSPDPQPV TLYSGEDYPS TAPVIQRVDV MNSTLVKVTW SSIPKETVHG 
       850        860        870        880        890        900 
LLRGYQINWW KTKSLLDGRT HPKEVNILRF SGQRNSGMVP SLDPFSEFHL TVLAYNSKGA 
       910        920        930        940        950        960 
GPESEPYIFQ TPEGVPEQPS FLKVIKVDKD TATLSWGLPK KLNGNLTGYL LQYQIINDTY 
       970        980        990       1000       1010       1020 
ELGELNEINV TTPSKSSWHL SNLNSTTKYK FYLRACTSRG CGKPISEEGA TLGEGSKGIR 
      1030       1040       1050       1060       1070       1080 
KITEGVNVTQ KIHPVEVLVP GAEHIVHLMT KNWGDNDSIF QDVIETRGRE YAGLYDDIST 
      1090       1100       1110       1120       1130       1140 
QGWFIGLMCA IALLTLILLT ICFVKRNRGG KYSVKEKEDL HPDPEVQSAK DETFGEYSDS 
      1150       1160       1170       1180       1190       1200 
DEKPLKGSLR SLNRNMQPTE SADSLVEYGE GDQSIFNEDG SFIGAYTGAK EKGSVESNGS 
   
STATFPLRA

Annotation ?

Network neighborhood
[show protein-protein interactions]
 
100
200
300
400
500
600
700
800
900
1000
1100
1200
Chains:
 
 
 
N-termini:

NNNN
 
C-termini:

CCCC
 
Cleavage sites:
  
 
Sequence variations:
         
 
 
Topology:
   
 
(VSWKP(753)|(754)QGAPE)
753,1209

Disintegrin and metalloproteinase domain-containing protein 8 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Bartsch JW Naus S et al.:Ectodomain shedding of the neur... (M12.208) unknown yes

Targeted features: ?

753,1209,1083,26 TOPO_DOM - Extracellular (Potential). (26|1083)
753,1209,1209,26 CHAIN - Neural cell adhesion molecule L1-like protein. (26|1209)
753,1209,807,714 DOMAIN - Fibronectin type-III 2. (714|807)

Affected feature boundaries: ?

753,1209,754,753 SITE - Cleavage; by ADAM8. (753|754)
 
(EVLVP(1040)|(1041)GAEHI)
1040,1209

Disintegrin and metalloproteinase domain-containing protein 8 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Bartsch JW Naus S et al.:Ectodomain shedding of the neur... (M12.208) unknown yes

Targeted features: ?

1040,1209,1083,26 TOPO_DOM - Extracellular (Potential). (26|1083)
1040,1209,1070,1016 VAR_SEQ - SKGIRKITEGVNVTQKIHPVEVLVPGAEHIVHLMTKNWGDN DSIFQDVIETRGRE -> K (in isoform 2). (1016|1070)
1040,1209,1209,26 CHAIN - Neural cell adhesion molecule L1-like protein. (26|1209)

Affected feature boundaries: ?

1040,1209,1041,1040 SITE - Cleavage; by ADAM8. (1040|1041)
 
unknown-1MMELPL...
1,1209

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from isoform by sequence similarity TopFIND inferred from TNt70577 indirect unknown (unknown)

Affected feature boundaries: ?

1,1209,25,1 SIGNAL - Potential. (1|25)
 
unknown-26EIPLSV...
26,1209

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt114081 indirect unknown (unknown)

Affected feature boundaries: ?

26,1209,1083,26 TOPO_DOM - Extracellular (Potential). (26|1083)
26,1209,1209,26 CHAIN - Neural cell adhesion molecule L1-like protein. (26|1209)
26,1209,0,26 CHAIN - Processed neural cell adhesion molecule L1-like protein (Potential). (26|0)
 
unknown-754QGAPEE...
754,1209

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC27878 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt156362 indirect unknown (unknown)
 
unknown-1041GAEHIV...
1041,1209

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC27880 indirect unknown (unknown)
 

Protein C-Termini [export]

...FPLRA0-unknown
0,1209

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

0,1209,0,26 CHAIN - Processed neural cell adhesion molecule L1-like protein (Potential). (26|0)
 
...VSWKP753-unknown
753,1209

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC27878 indirect unknown (unknown)
 
...EVLVP1040-unknown
1040,1209

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC27880 indirect unknown (unknown)
 
...FPLRA1209-unknown
1209,1209

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

1209,1209,1209,1105 TOPO_DOM - Cytoplasmic (Potential). (1105|1209)
1209,1209,1209,1138 VAR_SEQ - SDSDEKPLKGSLRSLNRNMQPTESADSLVEYGEGDQSIFNE DGSFIGAYTGAKEKGSVESNGSSTATFPLRA -> RKMVLK QKLLSWSSSRGRTFYSCTKNTLFDGSSVDMKTLQPLRYFSS NKHT (in isoform 2). (1138|1209)
1209,1209,1209,26 CHAIN - Neural cell adhesion molecule L1-like protein. (26|1209)
 
Filter by evidence: ?

Directness ?

  • unknown
  • indirect

Physiological relevance ?

  • yes
  • unknown

Evidencecode ?

Method ?

Perturbation ?

Confidence greater than?

  • unknown

Experimental system ?

Certainty of Protease assignment ?

  • unknown

Evidencecode ?

Tissue distribution ?

Specific evidence ?

Derived from database?

Laboratory ?