P78380: Oxidized low-density lipoprotein receptor 1 (Human)

Protein names
  • Oxidized low-density lipoprotein receptor 1 (Ox-LDL receptor 1)
  • C-type lectin domain family 8 member A (Ox-LDL receptor 1)
  • Lectin-like oxidized LDL receptor 1 Short=LOX-1 Short=Lectin-like oxLDL receptor 1 Short=hLOX-1 (Ox-LDL receptor 1)
  • Lectin-type oxidized LDL receptor 1 (Ox-LDL receptor 1)
  • OLR1
Gene names OLR1 (CLEC8A)
Organism Homo sapiens
Protease Family (Not Available)
Protease ID (Not Available)
Chromosome 12

Isoforms

  • Isoform 2 of Oxidized low-density lipoprotein receptor 1 (P78380-2): sequence view | extended view
  • Isoform 3 of Oxidized low-density lipoprotein receptor 1 (P78380-3): sequence view | extended view

Sequence

        10         20         30         40         50         60 
MTFDDLKIQT VKDQPDEKSN GKKAKGLQFL YSPWWCLAAA TLGVLCLGLV VTIMVLGMQL 
        70         80         90        100        110        120 
SQVSDLLTQE QANLTHQKKK LEGQISARQQ AEEASQESEN ELKEMIETLA RKLNEKSKEQ 
       130        140        150        160        170        180 
MELHHQNLNL QETLKRVANC SAPCPQDWIW HGENCYLFSS GSFNWEKSQE KCLSLDAKLL 
       190        200        210        220        230        240 
KINSTADLDF IQQAISYSSF PFWMGLSRRN PSYPWLWEDG SPLMPHLFRV RGAVSQTYPS 
       250        260        270    
GTCAYIQRGA VYAENCILAA FSICQKKANL RAQ

Annotation ?

Network neighborhood
[show protein-protein interactions]
 
100
200
Chains:
 
 
 
N-termini:

N
N
 
C-termini:
C
 
Features:
  
 
 
Modifications:
  
 
unknown-0QMTFDD...
0,273

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

0,273,273,0 CHAIN - Oxidized low-density lipoprotein receptor 1, soluble form. (0|273)
 
unknown-1MTFDDL...
1,273

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt83752 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt83753 indirect unknown (unknown)

Affected feature boundaries: ?

1,273,36,1 TOPO_DOM - Cytoplasmic (Potential). (1|36)
1,273,273,1 CHAIN - Oxidized low-density lipoprotein receptor 1. (1|273)
 

Protein C-Termini [export]

...NLRAQ273-unknown
273,273

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

273,273,273,142 VAR_SEQ - APCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKI NSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPL MPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSIC QKKANLRAQ -> GLHPASNFLFQFSILDGAVSEEPQLPMA LGGRFSFDAPLI (in isoform 2). (142|273)
273,273,273,189 VAR_SEQ - DFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFR VRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANL RAQ -> I (in isoform 3). (189|273)
273,273,273,58 TOPO_DOM - Extracellular (Potential). (58|273)
273,273,273,1 CHAIN - Oxidized low-density lipoprotein receptor 1. (1|273)
273,273,273,0 CHAIN - Oxidized low-density lipoprotein receptor 1, soluble form. (0|273)
273,273,273,267 MUTAGEN - Missing: Impairs protein folding and transport. (267|273)
 
Filter by evidence: ?

Directness ?

  • unknown
  • indirect

Physiological relevance ?

  • unknown

Evidencecode ?

Method ?

Perturbation ?

Confidence greater than?

  • unknown

Experimental system ?

Certainty of Protease assignment ?

  • unknown

Evidencecode ?

Tissue distribution ?

Specific evidence ?

Derived from database?

Laboratory ?