Q13261: Interleukin-15 receptor subunit alpha (Human)

Protein names
  • Interleukin-15 receptor subunit alpha (IL-15 receptor subunit alpha)
  • I15RA
Gene names IL15RA
Organism Homo sapiens
Protease Family (Not Available)
Protease ID (Not Available)
Chromosome 10

Isoforms

  • Isoform 2 of Interleukin-15 receptor subunit alpha (Q13261-3): sequence view | extended view
  • Isoform 3 of Interleukin-15 receptor subunit alpha (Q13261-4): sequence view | extended view
  • Isoform 4 of Interleukin-15 receptor subunit alpha (Q13261-5): sequence view | extended view
  • Isoform 5 of Interleukin-15 receptor subunit alpha (Q13261-6): sequence view | extended view
  • Isoform 6 of Interleukin-15 receptor subunit alpha (Q13261-7): sequence view | extended view
  • Isoform 7 of Interleukin-15 receptor subunit alpha (Q13261-8): sequence view | extended view
  • Isoform 8 of Interleukin-15 receptor subunit alpha (Q13261-9): sequence view | extended view

Sequence

        10         20         30         40         50         60 
MAPRRARGCR TLGLPALLLL LLLRPPATRG ITCPPPMSVE HADIWVKSYS LYSRERYICN 
        70         80         90        100        110        120 
SGFKRKAGTS SLTECVLNKA TNVAHWTTPS LKCIRDPALV HQRPAPPSTV TTAGVTPQPE 
       130        140        150        160        170        180 
SLSPSGKEPA ASSPSSNNTA ATTAAIVPGS QLMPSKSPST GTTEISSHES SHGTPSQTTA 
       190        200        210        220        230        240 
KNWELTASAS HQPPGVYPQG HSDTTVAIST STVLLCGLSA VSLLACYLKS RQTPPLASVE 
       250        260    
MEAMEALPVT WGTSSRDEDL ENCSHHL

Annotation ?

Network neighborhood
[show protein-protein interactions]
 
100
200
Chains:
 
 
 
N-termini:

NNN
 
C-termini:

CCCCC
 
Features:
  
 
Sequence variations:
 
 
     
 
unknown-1MAPRRA...
1,267

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from isoform by sequence similarity TopFIND inferred from TNt77407 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt77408 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt77409 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt77410 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt77411 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt77412 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt77413 indirect unknown (unknown)

Affected feature boundaries: ?

1,267,30,1 SIGNAL - Potential. (1|30)
 
unknown-31ITCPPP...
31,267

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt114824 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt114825 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt114826 indirect unknown (unknown)

Affected feature boundaries: ?

31,267,95,31 VAR_SEQ - Missing (in isoform 5 and isoform 6). (31|95)
31,267,205,31 TOPO_DOM - Extracellular (Potential). (31|205)
31,267,267,31 CHAIN - Interleukin-15 receptor subunit alpha. (31|267)
31,267,0,31 CHAIN - Soluble interleukin-15 receptor subunit alpha. (31|0)
31,267,95,31 DOMAIN - Sushi. (31|95)
 
unknown-37MSVEHA...
37,267

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation Ensembl inferred from ensembl protein ENSP00000380420 unknown unknown (unknown)
inferred from electronic annotation Ensembl inferred from ensembl protein ENSP00000405107 unknown unknown (unknown)
inferred from electronic annotation Ensembl inferred from ensembl protein ENSP00000380421 unknown unknown (unknown)
inferred from electronic annotation Ensembl inferred from ensembl protein ENSP00000431529 unknown unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt195805 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt195806 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt195807 indirect unknown (unknown)
 

Protein C-Termini [export]

...CSHHL0-unknown
0,267

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

0,267,0,31 CHAIN - Soluble interleukin-15 receptor subunit alpha. (31|0)
 
...KNWEL185-unknown
185,267

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation Ensembl inferred from ensembl protein ENSP00000405107 unknown unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt155474 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt155475 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt155476 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt155477 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt155478 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt155480 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt155479 indirect unknown (unknown)
 
...HSDTT205-unknown
205,267

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation Ensembl inferred from ensembl protein ENSP00000395113 unknown unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt155698 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt155699 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt155700 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt155701 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt155702 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt155704 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt155703 indirect unknown (unknown)

Affected feature boundaries: ?

205,267,205,31 TOPO_DOM - Extracellular (Potential). (31|205)
 
...YLKSR231-unknown
231,267

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation Ensembl inferred from ensembl protein ENSP00000380420 unknown unknown (unknown)
 
...CSHHL267-unknown
267,267

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt73030 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt73028 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt73025 indirect unknown (unknown)

Affected feature boundaries: ?

267,267,267,232 VAR_SEQ - QTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL -> A SVCSCHPRSAGHTCSVGSVC (in isoform 3, isoform 4, isoform 6 and isoform 8). (232|267)
267,267,267,229 TOPO_DOM - Cytoplasmic (Potential). (229|267)
267,267,267,31 CHAIN - Interleukin-15 receptor subunit alpha. (31|267)
 
Filter by evidence: ?

Directness ?

  • indirect
  • unknown

Physiological relevance ?

  • unknown

Evidencecode ?

Method ?

Perturbation ?

Confidence greater than?

  • unknown

Experimental system ?

Certainty of Protease assignment ?

  • unknown

Evidencecode ?

Tissue distribution ?

Specific evidence ?

Derived from database?

Laboratory ?