Q15172: Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform (Human)

Protein names
  • Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
  • PP2A B subunit isoform B'-alpha
  • PP2A B subunit isoform B56-alpha
  • PP2A B subunit isoform PR61-alpha Short=PR61alpha
  • PP2A B subunit isoform R5-alpha
  • 2A5A
Gene names PPP2R5A
Organism Homo sapiens
Protease Family (Not Available)
Protease ID (Not Available)
Chromosome 1

Isoforms

  • Isoform 2 of Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform (Q15172-2): sequence view | extended view

Sequence

        10         20         30         40         50         60 
MSSSSPPAGA ASAAISASEK VDGFTRKSVR KAQRQKRSQG SSQFRSQGSQ AELHPLPQLK 
        70         80         90        100        110        120 
DATSNEQQEL FCQKLQQCCI LFDFMDSVSD LKSKEIKRAT LNELVEYVST NRGVIVESAY 
       130        140        150        160        170        180 
SDIVKMISAN IFRTLPPSDN PDFDPEEDEP TLEASWPHIQ LVYEFFLRFL ESPDFQPSIA 
       190        200        210        220        230        240 
KRYIDQKFVQ QLLELFDSED PRERDFLKTV LHRIYGKFLG LRAFIRKQIN NIFLRFIYET 
       250        260        270        280        290        300 
EHFNGVAELL EILGSIINGF ALPLKAEHKQ FLMKVLIPMH TAKGLALFHA QLAYCVVQFL 
       310        320        330        340        350        360 
EKDTTLTEPV IRGLLKFWPK TCSQKEVMFL GEIEEILDVI EPTQFKKIEE PLFKQISKCV 
       370        380        390        400        410        420 
SSSHFQVAER ALYFWNNEYI LSLIEENIDK ILPIMFASLY KISKEHWNPT IVALVYNVLK 
       430        440        450        460        470        480 
TLMEMNGKLF DDLTSSYKAE RQREKKKELE REELWKKLEE LKLKKALEKQ NSAYNMHSIL 
   
SNTSAE

Annotation ?

Network neighborhood
[show protein-protein interactions]
 
100
200
300
400
Chains:
 
 
N-termini:

N
N
 
C-termini:
C
 
Features:
 
 
Sequence variations:
 
     
 
Modifications:
   
 
unknown-1MSSSSP...
1,486

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

1,486,61,1 VAR_SEQ - MSSSSPPAGAASAAISASEKVDGFTRKSVRKAQRQKRSQGS SQFRSQGSQAELHPLPQLKD -> MIMN (in isoform 2). (1|61)
1,486,1,1 INIT_MET - Removed. (1|1)
 
acetylation-2SSSSPP...
2,486

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
Gevaert K. Van Damme P et al.: Complementary positional proteomics for screening substrates... direct yes 0.0 (unknown)
CNRS/ISV Large_scale_NTA_Human direct yes 0.0 (MASCOT score)
Gevaert K. Van Damme P et al.: PC3-cells, Complementary positional proteomics for screening substrates... direct yes 0.0 (unknown)

Affected feature boundaries: ?

2,486,5,2 COMPBIAS - Poly-Ser. (2|5)
2,486,2,2 MOD_RES - N-acetylserine. (2|2)
2,486,486,2 CHAIN - Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform. (2|486)
 

Protein C-Termini [export]

...NTSAE486-unknown
486,486

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt61347 indirect unknown (unknown)

Affected feature boundaries: ?

486,486,486,2 CHAIN - Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform. (2|486)
 
Filter by evidence: ?

Directness ?

  • unknown
  • direct
  • indirect

Physiological relevance ?

  • unknown
  • yes

Evidencecode ?

Method ?

Perturbation ?

Confidence greater than?

  • unknown
  • MASCOT score

Experimental system ?

Certainty of Protease assignment ?

  • unknown
  • III proteolytic system present but impaired

Evidencecode ?

Tissue distribution ?

Specific evidence ?

Derived from database?

Laboratory ?