Q70SY1: Cyclic AMP-responsive element-binding protein 3-like protein 2 (Human)

Protein names
  • Cyclic AMP-responsive element-binding protein 3-like protein 2 (cAMP-responsive element-binding protein 3-like protein 2)
  • BBF2 human homolog on chromosome 7 (cAMP-responsive element-binding protein 3-like protein 2)
  • CR3L2
Gene names CREB3L2 (BBF2H7)
Organism Homo sapiens
Protease Family (Not Available)
Protease ID (Not Available)
Chromosome 7

Isoforms

  • Isoform 2 of Cyclic AMP-responsive element-binding protein 3-like protein 2 (Q70SY1-2): sequence view | extended view
  • Isoform 3 of Cyclic AMP-responsive element-binding protein 3-like protein 2 (Q70SY1-3): sequence view | extended view

Sequence

        10         20         30         40         50         60 
MEVLESGEQG VLQWDRKLSE LSEPGDGEAL MYHTHFSELL DEFSQNVLGQ LLNDPFLSEK 
        70         80         90        100        110        120 
SVSMEVEPSP TSPAPLIQAE HSYSLCEEPR AQSPFTHITT SDSFNDDEVE SEKWYLSTDF 
       130        140        150        160        170        180 
PSTSIKTEPV TDEPPPGLVP SVTLTITAIS TPLEKEEPPL EMNTGVDSSC QTIIPKIKLE 
       190        200        210        220        230        240 
PHEVDQFLNF SPKEAPVDHL HLPPTPPSSH GSDSEGSLSP NPRLHPFSLP QTHSPSRAAP 
       250        260        270        280        290        300 
RAPSALSSSP LLTAPHKLQG SGPLVLTEEE KRTLIAEGYP IPTKLPLSKS EEKALKKIRR 
       310        320        330        340        350        360 
KIKNKISAQE SRRKKKEYMD SLEKKVESCS TENLELRKKV EVLENTNRTL LQQLQKLQTL 
       370        380        390        400        410        420 
VMGKVSRTCK LAGTQTGTCL MVVVLCFAVA FGSFFQGYGP YPSATKMALP SQHSLQEPYT 
       430        440        450        460        470        480 
ASVVRSRNLL IYEEHSPPEE SSSPGSAGEL GGWDRGSSLL RVSGLESRPD VDLPHFIISN 
       490        500        510        520    
ETSLEKSVLL ELQQHLVSAK LEGNETLKVV ELDRRVNTTF 

Annotation ?

Network neighborhood
[show protein-protein interactions]
 
100
200
300
400
500
Chains:
 
 
 
N-termini:

NN
N
 
C-termini:

CCC
 
Cleavage sites:
 
 
Features:
 
  
 
Sequence variations:
    
 
 
Topology:
   
 
Modifications:
 
 
(SRNLL(430)|(431)IYEEH)
430,520

Membrane-bound transcription factor site-1 protease (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Seidah NG Pasquato A et al.:The proprotein convertase SKI-1... (S08.063) unknown yes

Targeted features: ?

430,520,520,249 VAR_SEQ - Missing (in isoform 3). (249|520)
430,520,520,424 VAR_SEQ - VRSRNLLIYEEHSPPEESSSPGSAGELGGWDRGSSLLRVSG LESRPDVDLPHFIISNETSLEKSVLLELQQHLVSAKLEGNE TLKVVELDRRVNTTF -> GKTACGKLGRVLFYFPRAGFLS LPKGIFCESPMFKKW (in isoform 2). (424|520)
430,520,520,401 TOPO_DOM - Lumenal (Potential). (401|520)
430,520,520,1 CHAIN - Cyclic AMP-responsive element-binding protein 3-like protein 2. (1|520)
 
unknown-1MEVLES...
1,520

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt71635 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt71636 indirect unknown (unknown)

Affected feature boundaries: ?

1,520,379,1 TOPO_DOM - Cytoplasmic (Potential). (1|379)
1,520,520,1 CHAIN - Cyclic AMP-responsive element-binding protein 3-like protein 2. (1|520)
1,520,0,1 CHAIN - Processed cyclic AMP-responsive element- binding protein 3-like protein 2. (1|0)
 
unknown-431IYEEHS...
431,520

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
Wells apoptosis_U266_bortezomib_induced direct yes 0.02 (ProteinProspector)
 
unknown-431IYEEHS...
431,520

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC16839 indirect unknown (unknown)
 

Protein C-Termini [export]

...VNTTF0-unknown
0,520

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

0,520,0,1 CHAIN - Processed cyclic AMP-responsive element- binding protein 3-like protein 2. (1|0)
 
...SRNLL430-unknown
430,520

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC16839 indirect unknown (unknown)
 
...VNTTF520-unknown
520,520

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

520,520,520,249 VAR_SEQ - Missing (in isoform 3). (249|520)
520,520,520,424 VAR_SEQ - VRSRNLLIYEEHSPPEESSSPGSAGELGGWDRGSSLLRVSG LESRPDVDLPHFIISNETSLEKSVLLELQQHLVSAKLEGNE TLKVVELDRRVNTTF -> GKTACGKLGRVLFYFPRAGFLS LPKGIFCESPMFKKW (in isoform 2). (424|520)
520,520,520,401 TOPO_DOM - Lumenal (Potential). (401|520)
520,520,520,1 CHAIN - Cyclic AMP-responsive element-binding protein 3-like protein 2. (1|520)
 
Filter by evidence: ?

Directness ?

  • unknown
  • indirect
  • direct

Physiological relevance ?

  • yes
  • unknown

Evidencecode ?

Method ?

Perturbation ?

Confidence greater than?

  • unknown
  • ProteinProspector

Experimental system ?

Certainty of Protease assignment ?

  • unknown

Evidencecode ?

Tissue distribution ?

Specific evidence ?

Derived from database?

Laboratory ?