Q811H0: Protein simiRP58 (Mouse)

Protein names
  • Protein simiRP58
Gene names Zbtb42
Organism Mus musculus
Protease Family (Not Available)
Protease ID (Not Available)
Chromosome 12

Isoforms

  • Isoform 2 of Zinc finger and BTB domain-containing protein 42 (Q811H0-2): sequence view | extended view

Sequence

        10         20         30         40         50         60 
MEFPEHGVRL LGRLRQQREL GFLCDCTVLV GDARFPAHRA VLAACSVYFH LFYRDQPASS 
        70         80         90        100        110        120 
RDTVRLNGDI VTVPAFSRLL DFMYEGRLDL HNLPVEDVLA AASYLHMYDI VKVCKGRLRK 
       130        140        150        160        170        180 
KDPDLETRTL GTELPGQPPH PLPSWSPAFC QAAPKAKHPS LGVKATHPLP TFGPPSWQVA 
       190        200        210        220        230        240 
EQSSGALDLS LKPSPRPEQV HPPCRLQTSL CSSVQQVAQP LVKAEQDSFS EQDSSSPQSA 
       250        260        270        280        290        300 
DRSPPPVCAS AAQGLAVDLE PLHIEGTGSQ QLGLPAEPVL DSEELGPSRH LCICPLCCKL 
       310        320        330        340        350        360 
FPSTHALQLH LSAHFRERDS VRARLSPEGS VPTCPLCSKT FSCTYTLKRH ERTHSGEKPY 
       370        380        390        400        410        420 
TCVQCGKSFQ YSHNLSRHAV VHTREKPHAC RWCERRFTQS GDLYRHVRKF HYGLVKPLLV 
   

Annotation ?

Network neighborhood
[show protein-protein interactions]
 
100
200
300
400
Chains:
 
 
N-termini:

N
 
C-termini:
C
 
Features:
 
 
Binding & active sites:
    
 
Sequence variations:
    
 
unknown-1MEFPEH...
1,420

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

1,420,420,1 CHAIN - Zinc finger and BTB domain-containing protein 42. (1|420)
1,420,178,1 VAR_SEQ - MEFPEHGVRLLGRLRQQRELGFLCDCTVLVGDARFPAHRAV LAACSVYFHLFYRDQPASSRDTVRLNGDIVTVPAFSRLLDF MYEGRLDLHNLPVEDVLAAASYLHMYDIVKVCKGRLRKKDP DLETRTLGTELPGQPPHPLPSWSPAFCQAAPKAKHPSLGVK ATHPLPTFGPPSWQ -> MTSSRSARADSERRTQIWRP (in isoform 2). (1|178)
 

Protein C-Termini [export]

...KPLLV420-unknown
420,420

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt90594 indirect unknown (unknown)

Affected feature boundaries: ?

420,420,420,1 CHAIN - Zinc finger and BTB domain-containing protein 42. (1|420)
 
Filter by evidence: ?

Directness ?

  • unknown
  • indirect

Physiological relevance ?

  • unknown

Evidencecode ?

Method ?

Perturbation ?

Confidence greater than?

  • unknown

Experimental system ?

Certainty of Protease assignment ?

  • unknown

Evidencecode ?

Tissue distribution ?

Specific evidence ?

Derived from database?

Laboratory ?