Q86VB7: Scavenger receptor cysteine-rich type 1 protein M130 (Human)

Protein names
  • Scavenger receptor cysteine-rich type 1 protein M130
  • Hemoglobin scavenger receptor
  • C163A
Gene names CD163 (M130)
Organism Homo sapiens
Protease Family (Not Available)
Protease ID (Not Available)
Chromosome 12

Isoforms

  • Isoform 2 of Scavenger receptor cysteine-rich type 1 protein M130 (Q86VB7-2): sequence view | extended view
  • Isoform 3 of Scavenger receptor cysteine-rich type 1 protein M130 (Q86VB7-3): sequence view | extended view
  • Isoform 4 of Scavenger receptor cysteine-rich type 1 protein M130 (Q86VB7-4): sequence view | extended view

Sequence

        10         20         30         40         50         60 
MSKLRMVLLE DSGSADFRRH FVNLSPFTIT VVLLLSACFV TSSLGGTDKE LRLVDGENKC 
        70         80         90        100        110        120 
SGRVEVKVQE EWGTVCNNGW SMEAVSVICN QLGCPTAIKA PGWANSSAGS GRIWMDHVSC 
       130        140        150        160        170        180 
RGNESALWDC KHDGWGKHSN CTHQQDAGVT CSDGSNLEMR LTRGGNMCSG RIEIKFQGRW 
       190        200        210        220        230        240 
GTVCDDNFNI DHASVICRQL ECGSAVSFSG SSNFGEGSGP IWFDDLICNG NESALWNCKH 
       250        260        270        280        290        300 
QGWGKHNCDH AEDAGVICSK GADLSLRLVD GVTECSGRLE VRFQGEWGTI CDDGWDSYDA 
       310        320        330        340        350        360 
AVACKQLGCP TAVTAIGRVN ASKGFGHIWL DSVSCQGHEP AIWQCKHHEW GKHYCNHNED 
       370        380        390        400        410        420 
AGVTCSDGSD LELRLRGGGS RCAGTVEVEI QRLLGKVCDR GWGLKEADVV CRQLGCGSAL 
       430        440        450        460        470        480 
KTSYQVYSKI QATNTWLFLS SCNGNETSLW DCKNWQWGGL TCDHYEEAKI TCSAHREPRL 
       490        500        510        520        530        540 
VGGDIPCSGR VEVKHGDTWG SICDSDFSLE AASVLCRELQ CGTVVSILGG AHFGEGNGQI 
       550        560        570        580        590        600 
WAEEFQCEGH ESHLSLCPVA PRPEGTCSHS RDVGVVCSRY TEIRLVNGKT PCEGRVELKT 
       610        620        630        640        650        660 
LGAWGSLCNS HWDIEDAHVL CQQLKCGVAL STPGGARFGK GNGQIWRHMF HCTGTEQHMG 
       670        680        690        700        710        720 
DCPVTALGAS LCPSEQVASV ICSGNQSQTL SSCNSSSLGP TRPTIPEESA VACIESGQLR 
       730        740        750        760        770        780 
LVNGGGRCAG RVEIYHEGSW GTICDDSWDL SDAHVVCRQL GCGEAINATG SAHFGEGTGP 
       790        800        810        820        830        840 
IWLDEMKCNG KESRIWQCHS HGWGQQNCRH KEDAGVICSE FMSLRLTSEA SREACAGRLE 
       850        860        870        880        890        900 
VFYNGAWGTV GKSSMSETTV GVVCRQLGCA DKGKINPASL DKAMSIPMWV DNVQCPKGPD 
       910        920        930        940        950        960 
TLWQCPSSPW EKRLASPSEE TWITCDNKIR LQEGPTSCSG RVEIWHGGSW GTVCDDSWDL 
       970        980        990       1000       1010       1020 
DDAQVVCQQL GCGPALKAFK EAEFGQGTGP IWLNEVKCKG NESSLWDCPA RRWGHSECGH 
      1030       1040       1050       1060       1070       1080 
KEDAAVNCTD ISVQKTPQKA TTGRSSRQSS FIAVGILGVV LLAIFVALFF LTKKRRQRQR 
      1090       1100       1110       1120       1130       1140 
LAVSSRGENL VHQIQYREMN SCLNADDLDL MNSSENSHES ADFSAAELIS VSKFLPISGM 
      1150    
EKEAILSHTE KENGNL

Annotation ?

Network neighborhood
[show protein-protein interactions]
 
100
200
300
400
500
600
700
800
900
1000
1100
Chains:
 
 
 
N-termini:

NNN
N
 
C-termini:

CC
 
Sequence variations:
      
 
 
Topology:
   
 
unknown-1MSKLRM...
1,1156

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from isoform by sequence similarity TopFIND inferred from TNt68785 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt68786 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt68787 indirect unknown (unknown)

Affected feature boundaries: ?

1,1156,41,1 SIGNAL - Potential. (1|41)
 
unknown-42SSLGGT...
42,1156

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt115445 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt115446 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt115447 indirect unknown (unknown)

Affected feature boundaries: ?

42,1156,1050,42 TOPO_DOM - Extracellular (Potential). (42|1050)
42,1156,1156,42 CHAIN - Scavenger receptor cysteine-rich type 1 protein M130. (42|1156)
42,1156,0,42 CHAIN - Soluble CD163. (42|0)
 
unknown-300AAVACK...
300,1156

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
Wells apoptotic_Jurkat_staurotrail direct yes 0.02 (ProteinProspector)
 
unknown-300AAVACK...
300,1156

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from isoform by sequence similarity TopFIND inferred from TNt171826 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt171827 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt171828 indirect unknown (unknown)
 

Protein C-Termini [export]

...ENGNL0-unknown
0,1156

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

0,1156,0,42 CHAIN - Soluble CD163. (42|0)
 
...ENGNL1156-unknown
1156,1156

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

1156,1156,1156,1115 VAR_SEQ - ENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGN L -> GLWVLGGSIAQGFRSVAAVEAQTFYFDKQLKKSKNV IGSLDAYNGQE (in isoform 2). (1115|1156)
1156,1156,1156,1115 VAR_SEQ - ENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGN L -> GGHSEPH (in isoform 3 and isoform 4). (1115|1156)
1156,1156,1156,1072 TOPO_DOM - Cytoplasmic (Potential). (1072|1156)
1156,1156,1156,42 CHAIN - Scavenger receptor cysteine-rich type 1 protein M130. (42|1156)
 
Filter by evidence: ?

Directness ?

  • indirect
  • unknown
  • direct

Physiological relevance ?

  • unknown
  • yes

Evidencecode ?

Method ?

Perturbation ?

Confidence greater than?

  • unknown
  • ProteinProspector

Experimental system ?

Certainty of Protease assignment ?

  • unknown

Evidencecode ?

Tissue distribution ?

Specific evidence ?

Derived from database?

Laboratory ?