Q8BTM8: Filamin-A (Mouse)

Protein names
  • Filamin-A (FLN-A)
  • Actin-binding protein 280 Short=ABP-280 (FLN-A)
  • Alpha-filamin (FLN-A)
  • Endothelial actin-binding protein (FLN-A)
  • Filamin-1 (FLN-A)
  • Non-muscle filamin (FLN-A)
  • FLNA
Gene names Flna (Fln, Fln1)
Organism Mus musculus
Protease Family (Not Available)
Protease ID (Not Available)
Chromosome X

Isoforms

  • Isoform 2 of Filamin-A (Q8BTM8-2): sequence view | extended view

Sequence

        10         20         30         40         50         60 
MSSSHSRCGQ SAAVASPGGS IDSRDAEMPA TEKDLAEDAP WKKIQQNTFT RWCNEHLKCV 
        70         80         90        100        110        120 
SKRIANLQTD LSDGLRLIAL LEVLSQKKMH RKHNQRPTFR QMQLENVSVA LEFLDRESIK 
       130        140        150        160        170        180 
LVSIDSKAIV DGNLKLILGL IWTLILHYSI SMPMWDEEED EEAKKQTPKQ RLLGWIQNKL 
       190        200        210        220        230        240 
PQLPITNFSR DWQSGRALGA LVDSCAPGLC PDWDSWDASK PVNNAREAMQ QADDWLGIPQ 
       250        260        270        280        290        300 
VITPEEIVDP NVDEHSVMTY LSQFPKAKLK PGAPLRPKLN PKKARAYGPG IEPTGNMVKK 
       310        320        330        340        350        360 
RAEFTVETRS AGQGEVLVYV EDPAGHQEEA KVTANNDKNR TFSVWYVPEV TGTHKVTVLF 
       370        380        390        400        410        420 
AGQHIAKSPF EVYVDKSQGD ASKVTAQGPG LEPSGNIANK TTYFEIFTAG AGMGEVEVVI 
       430        440        450        460        470        480 
QDPTGQKGTV EPQLEARGDS TYRCSYQPTM EGVHTVHVTF AGVPIPRSPY TVTVGQACNP 
       490        500        510        520        530        540 
AACRAIGRGL QPKGVRVKET ADFKVYTKGA GSGELKVTVK GPKGEERVKQ KDLGDGVYGF 
       550        560        570        580        590        600 
EYYPTIPGTY TVTITWGGQN IGRSPFEVKV GTECGNQKVR AWGPGLEGGI VGKSADFVVE 
       610        620        630        640        650        660 
AIGDDVGTLG FSVEGPSQAK IECDDKGDGS CDVRYWPQEA GEYAVHVLCN SEDIRLSPFM 
       670        680        690        700        710        720 
ADIREAPQDF HPDRVKARGP GLEKTGVAVN KPAEFTVDAK HAGKAPLRVQ VQDNEGCSVE 
       730        740        750        760        770        780 
ATVKDNGNGT YSCSYVPRKP VKHTAMVSWG GVSIPNSPFR VNVGAGSHPN KVKVYGPGVA 
       790        800        810        820        830        840 
KTGLKAHEPT YFTVDCTEAG QGDVSIGIKC APGVVGPTEA DIDFDIIRND NDTFTVKYTP 
       850        860        870        880        890        900 
CGAGSYTIMV LFADQATPTS PIRVKVEPSH DASKVKAEGP GLNRTGVELG KPTHFTVNAK 
       910        920        930        940        950        960 
TAGKGKLDVQ FSGLAKGDAV RDVDIIDHHD NTYTVKYIPV QQGPVGVNVT YGGDHIPKSP 
       970        980        990       1000       1010       1020 
FSVGVSPSLD LSKIKVSGLG DKVDVGKDQE FTVKSKGAGG QGKVASKIVS PSGAAVPCKV 
      1030       1040       1050       1060       1070       1080 
EPGLGADNSV VRFVPREEGP YEVEVTYDGV PVPGSPFPLE AVAPTKPSKV KAFGPGLQGG 
      1090       1100       1110       1120       1130       1140 
NAGSPARFTI DTKGAGTGGL GLTVEGPCEA QLECLDNGDG TCSVSYVPTE PGDYNINILF 
      1150       1160       1170       1180       1190       1200 
ADTHIPGSPF KAHVAPCFDA SKVKCSGPGL ERATAGEVGQ FQVDCSSAGS AELTIEICSE 
      1210       1220       1230       1240       1250       1260 
AGLPAEVYIQ DHGDGTHTIT YIPLCPGAYT VTIKYGGQPV PNFPSKLQVE PAVDTSGVQC 
      1270       1280       1290       1300       1310       1320 
YGPGIEGQGV FREATTEFSV DARALTQTGG PHVKARVANP SGNLTDTYVQ DCGDGTYKVE 
      1330       1340       1350       1360       1370       1380 
YTPYEEGVHS VDVTYDGSPV PSSPFQVPVT EGCDPSRVRV HGPGIQSGTT NKPNKFTVET 
      1390       1400       1410       1420       1430       1440 
RGAGTGGLGL AVEGPSEAKM SCMDNKDGSC SVEYIPYEAG TYSLNVTYGG HQVPGSPFKV 
      1450       1460       1470       1480       1490       1500 
PVHDVTDASK VKCSGPGLSP GMVRANLPQS FQVDTSKAGV APLQVKVQGP KGLVEPVDVV 
      1510       1520       1530       1540       1550       1560 
DNADGTQTVN YVPSREGSYS ISVLYGEEEV PRSPFKVKVL PTHDASKVKA SGPGLNTTGV 
      1570       1580       1590       1600       1610       1620 
PASLPVEFTI DAKDAGEGLL AVQITDPEGK PKKTHIQDNH DGTYTVAYVP DVPGRYTILI 
      1630       1640       1650       1660       1670       1680 
KYGGDEIPFS PYRVRAVPTG DASKCTVTVS IGGHGLGAGI GPTIQIGEET VITVDTKAAG 
      1690       1700       1710       1720       1730       1740 
KGKVTCTVCT PDGSEVDVDV VENEDGTFDI FYTAPQPGKY VICVRFGGEH VPNSPFQVTA 
      1750       1760       1770       1780       1790       1800 
LAGDQPTVQT PLRSQQLAPQ YNYPQGSQQT WIPERPMVGV NGLDVTSLRP FDLVIPFTIK 
      1810       1820       1830       1840       1850       1860 
KGEITGEVRM PSGKVAQPSI TDNKDGTVTV RYSPSEAGLH EMDIRYDNMH IPGSPLQFYV 
      1870       1880       1890       1900       1910       1920 
DYVNCGHITA YGPGLTHGVV NKPATFTVNT KDAGEGGLSL AIEGPSKAEI SCTDNQDGTC 
      1930       1940       1950       1960       1970       1980 
SVSYLPVLPG DYSILVKYND QHIPGSPFTA RVTGDDSMRM SHLKVGSAAD IPINISETDL 
      1990       2000       2010       2020       2030       2040 
SLLTATVVPP SGREEPCLLK RLRNGHVGIS FVPKETGEHL VHVKKNGQHV ASSPIPVVIS 
      2050       2060       2070       2080       2090       2100 
QSEIGDASRV RVSGQGLHEG HTFEPAEFII DTRDAGYGGL SLSIEGPSKV DINTEDLEDG 
      2110       2120       2130       2140       2150       2160 
TCRVTYCPTE PGNYIINIKF ADQHVPGSPF SVKVTGEGRV KESITRRRRA PSVANIGSHC 
      2170       2180       2190       2200       2210       2220 
DLSLKIPEIS IQDMTAQVTS PSGKTHEAEI VEGENHTYCI RFVPAEMGMH TVSVKYKGQH 
      2230       2240       2250       2260       2270       2280 
VPGSPFQFTV GPLGEGGAHK VRAGGPGLER AEVGVPAEFG IWTREAGAGG LAIAVEGPSK 
      2290       2300       2310       2320       2330       2340 
AEISFEDRKD GSCGVAYVVQ EPGDYEVSVK FNEEHIPDSP FVVPVASPSG DARRLTVSSL 
      2350       2360       2370       2380       2390       2400 
QESGLKVNQP ASFAVSLNGA KGAIDAKVHS PSGALEECYV TEIDQDKYAV RFIPRENGIY 
      2410       2420       2430       2440       2450       2460 
LIDVKFNGTH IPGSPFKIRV GEPGHGGDPG LVSAYGAGLE GGVTGSPAEF IVNTSNAGAG 
      2470       2480       2490       2500       2510       2520 
ALSVTIDGPS KVKMDCQECP EGYRVTYTPM APGSYLISIK YGGPYHIGGS PFKAKVTGPR 
      2530       2540       2550       2560       2570       2580 
LVSNHSLHET SSVFVDSLTK VATVPQHATS GPGPADVSKV VAKGLGLSKA YVGQKSNFTV 
      2590       2600       2610       2620       2630       2640 
DCSKAGNNML LVGVHGPRTP CEEILVKHMG SRLYSVSYLL KDKGEYTLVV KWGDEHIPGS 
   
PYRIMVP

Annotation ?

Network neighborhood
[show protein-protein interactions]
 
100
200
300
400
500
600
700
800
900
1000
1100
1200
1300
1400
1500
1600
1700
1800
1900
2000
2100
2200
2300
2400
2500
2600
Chains:
 
 
C-termini:
CCCCC
CCCCCC
CCC
 
Features:
  
     
 
 
Sequence variations:
  
   
 
(EEEDE(161)|(162)EAKKQ)
161,2647

Cathepsin E (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Merops CATE_MOUSE -> FLNA_MOUSE @161 unknown yes

Targeted features: ?

161,2647,274,2 DOMAIN - Actin-binding. (2|274)
161,2647,2647,2 CHAIN - Filamin-A. (2|2647)
161,2647,249,125 VAR_SEQ - DSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKK QTPKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVDSCA PGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQVITPEEI VD -> GEGTGYTGALSGCGRGRNKFFLSSPLESLLVVFPS CCTQPRLPLGPLAALFFEVLENKRLAWRACEPLRAPARSAL LACSQAELTSSVGRAPNAAPEVGQAQTRLLPLRAAPHPWDT HAF (125|249)
 
(MGEVE(417)|(418)VVIQD)
417,2647

Cathepsin E (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Merops CATE_MOUSE -> FLNA_MOUSE @417 unknown yes

Targeted features: ?

417,2647,474,376 REPEAT - Filamin 2. (376|474)
417,2647,2647,2 CHAIN - Filamin-A. (2|2647)
417,2647,2647,250 VAR_SEQ - Missing (in isoform 2). (250|2647)
 
(QDPTG(425)|(426)QKGTV)
425,2647

72 kDa type IV collagenase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Merops MMP2_MOUSE -> FLNA_MOUSE @425 unknown none

Targeted features: ?

425,2647,474,376 REPEAT - Filamin 2. (376|474)
425,2647,2647,2 CHAIN - Filamin-A. (2|2647)
425,2647,2647,250 VAR_SEQ - Missing (in isoform 2). (250|2647)
 
(NKPAE(694)|(695)FTVDA)
694,2647

72 kDa type IV collagenase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Overall CM Prudova A et al.:Multiplex N-terminome analysis ... (M10.004) unknown none

Targeted features: ?

694,2647,763,667 REPEAT - Filamin 5. (667|763)
694,2647,2647,2 CHAIN - Filamin-A. (2|2647)
694,2647,2647,250 VAR_SEQ - Missing (in isoform 2). (250|2647)
 
(LDVQF(911)|(912)SGLAK)
911,2647

Cathepsin E (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Merops CATE_MOUSE -> FLNA_MOUSE @911 unknown yes

Targeted features: ?

911,2647,965,867 REPEAT - Filamin 7. (867|965)
911,2647,2647,2 CHAIN - Filamin-A. (2|2647)
911,2647,2647,250 VAR_SEQ - Missing (in isoform 2). (250|2647)
 
(VQFSG(913)|(914)LAKGD)
913,2647

Cathepsin E (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Merops CATE_MOUSE -> FLNA_MOUSE @913 unknown yes

Targeted features: ?

913,2647,965,867 REPEAT - Filamin 7. (867|965)
913,2647,2647,2 CHAIN - Filamin-A. (2|2647)
913,2647,2647,250 VAR_SEQ - Missing (in isoform 2). (250|2647)
 
(KVASK(1007)|(1008)IVSPS)
1007,2647

72 kDa type IV collagenase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Merops MMP2_MOUSE -> FLNA_MOUSE @1007 unknown none

Targeted features: ?

1007,2647,1061,966 REPEAT - Filamin 8. (966|1061)
1007,2647,2647,2 CHAIN - Filamin-A. (2|2647)
1007,2647,2647,250 VAR_SEQ - Missing (in isoform 2). (250|2647)
 
(GSPFP(1058)|(1059)LEAVA)
1058,2647

72 kDa type IV collagenase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Overall CM Prudova A et al.:Multiplex N-terminome analysis ... (M10.004) unknown none

Matrix metalloproteinase-9 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Overall CM Prudova A et al.:Multiplex N-terminome analysis ... (M10.004) unknown none

Targeted features: ?

1058,2647,2647,2 CHAIN - Filamin-A. (2|2647)
1058,2647,2647,250 VAR_SEQ - Missing (in isoform 2). (250|2647)
 
(TKPSK(1069)|(1070)VKAFG)
1069,2647

72 kDa type IV collagenase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Overall CM Prudova A et al.:Multiplex N-terminome analysis ... (M10.004) unknown none

Targeted features: ?

1069,2647,1154,1062 REPEAT - Filamin 9. (1062|1154)
1069,2647,2647,2 CHAIN - Filamin-A. (2|2647)
1069,2647,2647,250 VAR_SEQ - Missing (in isoform 2). (250|2647)
 
(VAPCF(1158)|(1159)DASKV)
1158,2647

Cathepsin E (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Merops CATE_MOUSE -> FLNA_MOUSE @1158 unknown yes

Targeted features: ?

1158,2647,1249,1155 REPEAT - Filamin 10. (1155|1249)
1158,2647,2647,2 CHAIN - Filamin-A. (2|2647)
1158,2647,2647,250 VAR_SEQ - Missing (in isoform 2). (250|2647)
 
(EGSYS(1520)|(1521)ISVLY)
1520,2647

72 kDa type IV collagenase (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Overall CM Prudova A et al.:Multiplex N-terminome analysis ... (M10.004) unknown none

Targeted features: ?

1520,2647,1539,1443 REPEAT - Filamin 13. (1443|1539)
1520,2647,2647,2 CHAIN - Filamin-A. (2|2647)
1520,2647,1607,1490 REGION - Interaction with furin. (1490|1607)
1520,2647,2647,250 VAR_SEQ - Missing (in isoform 2). (250|2647)
 
(SISVL(1524)|(1525)YGEEE)
1524,2647

Cathepsin E (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Merops CATE_MOUSE -> FLNA_MOUSE @1524 unknown yes

Targeted features: ?

1524,2647,1539,1443 REPEAT - Filamin 13. (1443|1539)
1524,2647,2647,2 CHAIN - Filamin-A. (2|2647)
1524,2647,1607,1490 REGION - Interaction with furin. (1490|1607)
1524,2647,2647,250 VAR_SEQ - Missing (in isoform 2). (250|2647)
 
(RPFDL(1793)|(1794)VIPFT)
1793,2647

Cathepsin E (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Merops CATE_MOUSE -> FLNA_MOUSE @1793 unknown yes

Targeted features: ?

1793,2647,1860,1765 REPEAT - Filamin 16. (1765|1860)
1793,2647,2647,2 CHAIN - Filamin-A. (2|2647)
1793,2647,2647,250 VAR_SEQ - Missing (in isoform 2). (250|2647)
 
unknown-1MSSSHS...
1,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from similarity UniProtKB inferred from uniprot (by similarity) unknown unknown (unknown)

Affected feature boundaries: ?

1,2647,1,1 INIT_MET - Removed (By similarity). (1|1)
 
unknown-1MSSSHS...
1,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from isoform by sequence similarity TopFIND inferred from TNt75256 indirect unknown (unknown)

Affected feature boundaries: ?

1,2647,1,1 INIT_MET - Removed (By similarity). (1|1)
 
acetylation-2SSSHSR...
2,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt110299 indirect unknown (unknown)

Affected feature boundaries: ?

2,2647,2,2 MOD_RES - N-acetylserine (By similarity). (2|2)
2,2647,274,2 DOMAIN - Actin-binding. (2|274)
2,2647,2647,2 CHAIN - Filamin-A. (2|2647)
 
unknown-29PATEKD...
29,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
Overall CM. auf dem Keller U.: A statistics-based platform for quantitative N-terminome... direct likely 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt160600 indirect unknown (unknown)
 
unknown-162EAKKQT...
162,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC30738 indirect unknown (unknown)
 
unknown-418VVIQDP...
418,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC30739 indirect unknown (unknown)
 
unknown-426QKGTVE...
426,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC34084 indirect unknown (unknown)
 
unknown-695FTVDAK...
695,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC34085 indirect unknown (unknown)
 
unknown-912SGLAKG...
912,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC30740 indirect unknown (unknown)
 
unknown-914LAKGDA...
914,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC30741 indirect unknown (unknown)
 
unknown-1008IVSPSG...
1008,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC33128 indirect unknown (unknown)
 
unknown-1059LEAVAP...
1059,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC34086 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34634 indirect unknown (unknown)
 
unknown-1070VKAFGP...
1070,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC34087 indirect unknown (unknown)
 
unknown-1159DASKVK...
1159,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC30742 indirect unknown (unknown)
 
unknown-1273EATTEF...
1273,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
Overall CM. auf dem Keller U.: A statistics-based platform for quantitative N-terminome... direct likely 0.0 (unknown)
 
unknown-1505GTQTVN...
1505,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
Overall CM. auf dem Keller U.: A statistics-based platform for quantitative N-terminome... direct likely 0.0 (unknown)
 
unknown-1521ISVLYG...
1521,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC34088 indirect unknown (unknown)
 
unknown-1525YGEEEV...
1525,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC30743 indirect unknown (unknown)
 
unknown-1794VIPFTI...
1794,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC30744 indirect unknown (unknown)
 

Protein C-Termini [export]

...EEEDE161-unknown
161,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC30738 indirect unknown (unknown)
 
...MGEVE417-unknown
417,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC30739 indirect unknown (unknown)
 
...QDPTG425-unknown
425,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC34084 indirect unknown (unknown)
 
...NKPAE694-unknown
694,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC34085 indirect unknown (unknown)
 
...LDVQF911-unknown
911,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC30740 indirect unknown (unknown)
 
...VQFSG913-unknown
913,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC30741 indirect unknown (unknown)
 
...KVASK1007-unknown
1007,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC33128 indirect unknown (unknown)
 
...GSPFP1058-unknown
1058,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC34086 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC34634 indirect unknown (unknown)
 
...TKPSK1069-unknown
1069,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC34087 indirect unknown (unknown)
 
...VAPCF1158-unknown
1158,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC30742 indirect unknown (unknown)
 
...EGSYS1520-unknown
1520,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC34088 indirect unknown (unknown)
 
...SISVL1524-unknown
1524,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC30743 indirect unknown (unknown)
 
...RPFDL1793-unknown
1793,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC30744 indirect unknown (unknown)
 
...RIMVP2647-unknown
2647,2647

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

2647,2647,2647,2 CHAIN - Filamin-A. (2|2647)
2647,2647,2647,2517 REGION - Self-association site, tail (By similarity). (2517|2647)
2647,2647,2647,250 VAR_SEQ - Missing (in isoform 2). (250|2647)
 
Filter by evidence: ?

Directness ?

  • unknown
  • indirect
  • direct

Physiological relevance ?

  • yes
  • none
  • unknown
  • likely

Evidencecode ?

Method ?

Perturbation ?

Confidence greater than?

  • unknown

Experimental system ?

Certainty of Protease assignment ?

  • unknown

Evidencecode ?

Tissue distribution ?

Specific evidence ?

Derived from database?

Laboratory ?