Q9BXT6: Putative helicase Mov10l1 (Human)

Protein names
  • Putative helicase Mov10l1
  • Moloney leukemia virus 10-like protein 1 Short=MOV10-like protein 1
  • M10L1
Gene names MOV10L1
Organism Homo sapiens
Protease Family (Not Available)
Protease ID (Not Available)
Chromosome 22

Isoforms

  • Isoform 2 of Putative helicase Mov10l1 (Q9BXT6-2): sequence view | extended view
  • Isoform 3 of Putative helicase Mov10l1 (Q9BXT6-3): sequence view | extended view
  • Isoform 4 of Putative helicase Mov10l1 (Q9BXT6-4): sequence view | extended view
  • Isoform 5 of Putative helicase Mov10l1 (Q9BXT6-5): sequence view | extended view

Sequence

        10         20         30         40         50         60 
MLSLAAKLVA FFWRTADTPR EEAGQLEPEL AEGDTKLKTV RGVVTRYCSD YGMIDDMIYF 
        70         80         90        100        110        120 
SSDAVTSRVL LNVGQEVIAV VEENKVSNGL KAIRVEAVSD KWEDDSRNHG SPSDCGPRVL 
       130        140        150        160        170        180 
IGCVTSLVEG AGCISQTTYF SLESVCEGFE PCKGDWVEAE YRIRPGTWSS EATSVKPLRY 
       190        200        210        220        230        240 
KRVDKVCISS LCGRNGVLEE SIFFTLDSLK LPDGYTPRRG DVVNAVVVES SQSCYVWRAL 
       250        260        270        280        290        300 
CMTLVKRRDA APVHEATHFY GTILLKNKGD IEVTQVTHFG TLKEGRSKTM VIWIENKGDI 
       310        320        330        340        350        360 
PQNLVSCKLA GWDKSKQFRF QMLDKDQMCP VVSFVSVPEK ENSSDENINS LNSHTKNKTS 
       370        380        390        400        410        420 
QMSESSLVNN RGISPGDCTC KGENGEKDNI LSRKQMTEPE PGGLVPPGGK TFIVVICDGK 
       430        440        450        460        470        480 
NPGRCKELLL LCFSDFLIGR YLEVNVISGE ESLIAAREPF SWKKLKSSQA LTSAKTTVVV 
       490        500        510        520        530        540 
TAQKRNSRRQ LPSFLPQYPI PDRLRKCVEQ KIDILTFQPL LAELLNMSNY KEKFSTLLWL 
       550        560        570        580        590        600 
EEIYAEMELK EYNMSGIILR RNGDLLVLEV PGLAEGRPSL YAGDKLILKT QEYNGHAIEY 
       610        620        630        640        650        660 
ISYVTEIHEE DVTLKINPEF EQAYNFEPMD VEFTYNRTTS RRCHFALEHV IHLGVKVLFP 
       670        680        690        700        710        720 
EEIILQSPQV TGNWNHAQDT KSSGQSTSKK NRKTMTDQAE HGTEERRVGD KDLPVLAPFT 
       730        740        750        760        770        780 
AEMSDWVDEI QTPKARKMEF FNPVLNENQK LAVKRILSGD CRPLPYILFG PPGTGKTVTI 
       790        800        810        820        830        840 
IEAVLQVHFA LPDSRILVCA PSNSAADLVC LRLHESKVLQ PATMVRVNAT CRFEEIVIDA 
       850        860        870        880        890        900 
VKPYCRDGED IWKASRFRII ITTCSSSGLF YQIGVRVGHF THVFVDEAGQ ASEPECLIPL 
       910        920        930        940        950        960 
GLMSDISGQI VLAGDPMQLG PVIKSRLAMA YGLNVSFLER LMSRPAYQRD ENAFGACGAH 
       970        980        990       1000       1010       1020 
NPLLVTKLVK NYRSHEALLM LPSRLFYHRE LEVCADPTVV TSLLGWEKLP KKGFPLIFHG 
      1030       1040       1050       1060       1070       1080 
VRGSEAREGK SPSWFNPAEA VQVLRYCCLL AHSISSQVSA SDIGVITPYR KQVEKIRILL 
      1090       1100       1110       1120       1130       1140 
RNVDLMDIKV GSVEEFQGQE YLVIIISTVR SNEDRFEDDR YFLGFLSNSK RFNVAITRPK 
      1150       1160       1170       1180       1190       1200 
ALLIVLGNPH VLVRDPCFGA LLEYSITNGV YMGCDLPPAL QSLQNCGEGV ADPSYPVVPE 
      1210    
STGPEKHQEP S

Annotation ?

Network neighborhood
[show protein-protein interactions]
 
100
200
300
400
500
600
700
800
900
1000
1100
1200
Chains:
 
 
N-termini:

N
 
C-termini:
C
 
Features:
 
 
Binding & active sites:
 
 
unknown-1MLSLAA...
1,1211

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt80143 indirect unknown (unknown)

Affected feature boundaries: ?

1,1211,902,1 VAR_SEQ - Missing (in isoform 3). (1|902)
1,1211,873,1 VAR_SEQ - Missing (in isoform 2). (1|873)
1,1211,32,1 VAR_SEQ - MLSLAAKLVAFFWRTADTPREEAGQLEPELAE -> MSFLP VRSVIGG (in isoform 5). (1|32)
1,1211,1211,1 CHAIN - Putative helicase Mov10l1. (1|1211)
 

Protein C-Termini [export]

...HQEPS1211-unknown
1211,1211

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt75759 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt75761 indirect unknown (unknown)

Affected feature boundaries: ?

1211,1211,1211,1083 VAR_SEQ - Missing (in isoform 3). (1083|1211)
1211,1211,1211,1155 VAR_SEQ - DPCFGALLEYSITNGVYMGCDLPPALQSLQNCGEGVADPSY PVVPESTGPEKHQEPS -> LWRGGGRPLLPSGARIHRTRE ASGAQLICSG (in isoform 5). (1155|1211)
1211,1211,1211,1 CHAIN - Putative helicase Mov10l1. (1|1211)
 
Filter by evidence: ?

Directness ?

  • unknown
  • indirect

Physiological relevance ?

  • unknown

Evidencecode ?

Method ?

Perturbation ?

Confidence greater than?

  • unknown

Experimental system ?

Certainty of Protease assignment ?

  • unknown

Evidencecode ?

Tissue distribution ?

Specific evidence ?

Derived from database?

Laboratory ?