Q9FI53: Fumarate hydratase 2, chloroplastic (Mouse-ear cress)

Protein names
  • Fumarate hydratase 2, chloroplastic (Fumarase 2)
  • FUM2
Gene names FUM2
Organism Arabidopsis thaliana
Protease Family (Not Available)
Protease ID (Not Available)
Chromosome 5

Isoforms

  • Isoform 2 of Fumarate hydratase 2, chloroplastic (Q9FI53-2): sequence view | extended view
  • Isoform 3 of Fumarate hydratase 2, chloroplastic (Q9FI53-3): sequence view | extended view

Sequence

        10         20         30         40         50         60 
MAALTMQFEG EKKNVSEVAD VTLKQEDEQQ ERRSYSTPFR EERDTFGPIQ VPSDKLWGAQ 
        70         80         90        100        110        120 
TQRSLQNFEI GGDRERMPEP IVRAFGVLKK CAAKVNMEYG LDPMIGEAIM EAAQEVAEGK 
       130        140        150        160        170        180 
LNDHFPLVVW QTGSGTQSNM NANEVIANRA AEILGHKRGE KIVHPNDHVN RSQSSNDTFP 
       190        200        210        220        230        240 
TVMHIAAATE ITSRLIPSLK NLHSSLESKS FEFKDIVKIG RTHTQDATPL TLGQEFGGYA 
       250        260        270        280        290        300 
TQVEYGLNRV ACTLPRIYQL AQGGTAVGTG LNTKKGFDVK IAAAVAEETN LPFVTAENKF 
       310        320        330        340        350        360 
EALAAHDACV ETSGSLNTIA TSLMKIANDI RFLGSGPRCG LGELSLPENE PGSSIMPGKV 
       370        380        390        400        410        420 
NPTQCEALTM VCAQVMGNHV AVTIGGSNGH FELNVFKPVI ASALLHSIRL IADASASFEK 
       430        440        450        460        470        480 
NCVRGIEANR ERISKLLHES LMLVTSLNPK IGYDNAAAVA KRAHKEGCTL KHAAMKLGVL 
       490    
TSEEFDTLVV PEKMIGPSD

Annotation ?

Network neighborhood
[show protein-protein interactions]
 
100
200
300
400
Chains:

 
 
N-termini:

N
N
 
C-termini:
C
 
Features:
   
 
Binding & active sites:
 
 
Sequence variations:
  
 
 
unknown-0DMAALT...
0,499

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

0,499,499,0 CHAIN - Fumarate hydratase 2, chloroplastic. (0|499)
 
unknown-1MAALTM...
1,499

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from isoform by sequence similarity TopFIND inferred from TNt75537 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt75538 indirect unknown (unknown)

Affected feature boundaries: ?

1,499,0,1 TRANSIT - Chloroplast (Potential). (1|0)
 

Protein C-Termini [export]

...IGPSD499-unknown
499,499

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

499,499,499,0 CHAIN - Fumarate hydratase 2, chloroplastic. (0|499)
499,499,499,215 VAR_SEQ - Missing (in isoform 3). (215|499)
499,499,499,472 VAR_SEQ - HAAMKLGVLTSEEFDTLVVPEKMIGPSD -> VNNKLLTFS SLNKSEFKPIFSKRKHVHVCYNIFVVLFWI (in isoform 2). (472|499)
 
Filter by evidence: ?

Directness ?

  • unknown
  • indirect

Physiological relevance ?

  • unknown

Evidencecode ?

Method ?

Perturbation ?

Confidence greater than?

  • unknown

Experimental system ?

Certainty of Protease assignment ?

  • unknown

Evidencecode ?

Tissue distribution ?

Specific evidence ?

Derived from database?

Laboratory ?