Q9H013: Disintegrin and metalloproteinase domain-containing protein 19 (Human)

Protein names
  • Disintegrin and metalloproteinase domain-containing protein 19 (ADAM 19)
  • Meltrin-beta (ADAM 19)
  • Metalloprotease and disintegrin dendritic antigen marker Short=MADDAM (ADAM 19)
  • ADA19
Gene names ADAM19 (MLTNB)
Organism Homo sapiens
Protease Family M12 (MEROPS)
Protease ID M12.214 (MEROPS)
Chromosome 5

Isoforms

  • Isoform B of Disintegrin and metalloproteinase domain-containing protein 19 (Q9H013-2): sequence view | extended view

Sequence

        10         20         30         40         50         60 
MPGGAGAARL CLLAFALQPL RPRAAREPGW TRGSEEGSPK LQHELIIPQW KTSESPVREK 
        70         80         90        100        110        120 
HPLKAELRVM AEGRELILDL EKNEQLFAPS YTETHYTSSG NPQTTTRKLE DHCFYHGTVR 
       130        140        150        160        170        180 
ETELSSVTLS TCRGIRGLIT VSSNLSYVIE PLPDSKGQHL IYRSEHLKPP PGNCGFEHSK 
       190        200        210        220        230        240 
PTTRDWALQF TQQTKKRPRR MKREDLNSMK YVELYLVADY LEFQKNRRDQ DATKHKLIEI 
       250        260        270        280        290        300 
ANYVDKFYRS LNIRIALVGL EVWTHGNMCE VSENPYSTLW SFLSWRRKLL AQKYHDNAQL 
       310        320        330        340        350        360 
ITGMSFHGTT IGLAPLMAMC SVYQSGGVNM DHSENAIGVA ATMAHEMGHN FGMTHDSADC 
       370        380        390        400        410        420 
CSASAADGGC IMAAATGHPF PKVFNGCNRR ELDRYLQSGG GMCLSNMPDT RMLYGGRRCG 
       430        440        450        460        470        480 
NGYLEDGEEC DCGEEEECNN PCCNASNCTL RPGAECAHGS CCHQCKLLAP GTLCREQARQ 
       490        500        510        520        530        540 
CDLPEFCTGK SPHCPTNFYQ MDGTPCEGGQ AYCYNGMCLT YQEQCQQLWG PGARPAPDLC 
       550        560        570        580        590        600 
FEKVNVAGDT FGNCGKDMNG EHRKCNMRDA KCGKIQCQSS EARPLESNAV PIDTTIIMNG 
       610        620        630        640        650        660 
RQIQCRGTHV YRGPEEEGDM LDPGLVMTGT KCGYNHICFE GQCRNTSFFE TEGCGKKCNG 
       670        680        690        700        710        720 
HGVCNNNQNC HCLPGWAPPF CNTPGHGGSI DSGPMPPESV GPVVAGVLVA ILVLAVLMLM 
       730        740        750        760        770        780 
YYCCRQNNKL GQLKPSALPS KLRQQFSCPF RVSQNSGTGH ANPTFKLQTP QGKRKVINTP 
       790        800        810        820        830        840 
EILRKPSQPP PRPPPDYLRG GSPPAPLPAH LSRAARNSPG PGSQIERTES SRRPPPSRPI 
       850        860        870        880        890        900 
PPAPNCIVSQ DFSRPRPPQK ALPANPVPGR RSLPRPGGAS PLRPPGAGPQ QSRPLAALAP 
       910        920        930        940        950    
KVSPREALKV KAGTRGLQGG RCRVEKTKQF MLLVVWTELP EQKPRAKHSC FLVPA

Annotation ?

Network neighborhood
[show protein-protein interactions]
 
100
200
300
400
500
600
700
800
900
Chains:
 
 
N-termini:

NNN
NN
 
C-termini:
CCC
 
Cleavage sites:
 
 
 
 
 
  
 
Features:
  
     
 
Binding & active sites:
     
 
Sequence variations:
        
 
Topology:
   
 
(RRMKR(203)|(204)EDLNS)
203,955

Neuroendocrine convertase 2 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Remacle AG et al.:Substrate cleavage analysis of ... (S08.071) unknown unknown

Proprotein convertase subtilisin/kexin type 4 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Remacle AG et al.:Substrate cleavage analysis of ... (S08.071) unknown unknown

Proprotein convertase subtilisin/kexin type 6 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Remacle AG et al.:Substrate cleavage analysis of ... (S08.071) unknown unknown

Furin (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Merops FURIN_HUMAN -> ADA19_HUMAN @203 unknown yes

Proprotein convertase subtilisin/kexin type 5 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Remacle AG et al.:Substrate cleavage analysis of ... (S08.071) unknown unknown

Proprotein convertase subtilisin/kexin type 7 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Strongin AY Remacle AG et al.:Substrate cleavage analysis of ... (S08.071) unknown unknown

Affected feature boundaries: ?

203,955,699,203 TOPO_DOM - Extracellular (Potential). (203|699)
203,955,955,203 CHAIN - Disintegrin and metalloproteinase domain- containing protein 19. (203|955)
203,955,202,26 PROPEP - By similarity. (26|202)
 
(ARPLE(586)|(587)SNAVP)
586,955

Disintegrin and metalloproteinase domain-containing protein 19 (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Sang QX Kang T et al.:Autolytic processing at Glu586-... (M12.214) unknown yes

Targeted features: ?

586,955,649,502 COMPBIAS - Cys-rich. (502|649)
586,955,699,203 TOPO_DOM - Extracellular (Potential). (203|699)
586,955,955,203 CHAIN - Disintegrin and metalloproteinase domain- containing protein 19. (203|955)
 
unknown-1MPGGAG...
1,955

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from isoform by sequence similarity TopFIND inferred from TNt66272 indirect unknown (unknown)

Affected feature boundaries: ?

1,955,25,1 SIGNAL - Potential. (1|25)
 
unknown-26REPGWT...
26,955

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt114098 indirect unknown (unknown)

Affected feature boundaries: ?

26,955,202,26 PROPEP - By similarity. (26|202)
 
unknown-203REDLNS...
203,955

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt116018 indirect unknown (unknown)

Affected feature boundaries: ?

203,955,699,203 TOPO_DOM - Extracellular (Potential). (203|699)
203,955,955,203 CHAIN - Disintegrin and metalloproteinase domain- containing protein 19. (203|955)
 
unknown-204EDLNSM...
204,955

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC26658 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC26928 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC27226 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC9826 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC27078 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC27373 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt146660 indirect unknown (unknown)
 
unknown-587SNAVPI...
587,955

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC160 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt154420 indirect unknown (unknown)
 

Protein C-Termini [export]

...RRMKR203-unknown
203,955

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC26658 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC26928 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC27226 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC9826 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC27078 indirect unknown (unknown)
inferred from cleavage TopFIND Inferred from cleavage TC27373 indirect unknown (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt129970 indirect unknown (unknown)
 
...ARPLE586-unknown
586,955

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from cleavage TopFIND Inferred from cleavage TC160 indirect unknown (unknown)
 
...FLVPA955-unknown
955,955

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

955,955,955,902 VAR_SEQ - VSPREALKVKAGTRGLQGGRCRVEKTKQFMLLVVWTELPEQ KPRAKHSCFLVPA -> FPEYRSQRAGGMISSKI (in isoform B). (902|955)
955,955,955,721 TOPO_DOM - Cytoplasmic (Potential). (721|955)
955,955,955,203 CHAIN - Disintegrin and metalloproteinase domain- containing protein 19. (203|955)
 
78 (QAVR.|.SSSR)
78,233

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Blobel CP Chesneau V et al.:Catalytic properties of ADAM19.... (M12.214) unknown yes
 
79 (AVRS.|.SSRT)
79,233

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Blobel CP Chesneau V et al.:Catalytic properties of ADAM19.... (M12.214) unknown yes
 
155 ()
155,238

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from isoform by sequence similarity TopFIND inferred from TC158 indirect unknown
 
190 (PVAA.|.SSLR)
190,273

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Blobel CP Chesneau V et al.:Catalytic properties of ADAM19.... (M12.214) unknown none
 
586 (RPLE.|.SNAV)
586,955

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from experiment MEROPS Sang QX Kang T et al.:Autolytic processing at Glu586-... (M12.214) unknown yes
 
586 ()
586,918

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance
inferred from isoform by sequence similarity TopFIND inferred from TC160 indirect unknown
 
Filter by evidence: ?

Directness ?

  • unknown
  • indirect

Physiological relevance ?

  • unknown
  • yes
  • none

Evidencecode ?

Method ?

Perturbation ?

Confidence greater than?

  • unknown

Experimental system ?

Certainty of Protease assignment ?

  • unknown

Evidencecode ?

Tissue distribution ?

Specific evidence ?

Derived from database?

Laboratory ?