Q9Z319: Atrial natriuretic peptide-converting enzyme (Mouse)

Protein names
  • Atrial natriuretic peptide-converting enzyme
  • Corin
  • Low density lipoprotein receptor-related protein 4
  • Pro-ANP-converting enzyme
  • CORIN
Gene names Corin (Crn, Lrp4)
Organism Mus musculus
Protease Family S01 (MEROPS)
Protease ID S01.019 (MEROPS)
Chromosome 5

Isoforms

  • Isoform 2 of Atrial natriuretic peptide-converting enzyme (Q9Z319-2): sequence view | extended view

Sequence

        10         20         30         40         50         60 
MGRVSFSVRV SSVRRARCSC PGRCYLSCRV PPTTALRALN GLGCAGVPGE TAGGAVGPGP 
        70         80         90        100        110        120 
LGTRGFLSGS KFQAPGSWKD CFGAPPAPDV LRADRSVGEG CPQKLVTANL LRFLLLVLIP 
       130        140        150        160        170        180 
CICALIVLLA ILLSFVGTLK RVYFKSNDSE PLVTDGEARV PGVIPVNTVY YENTGAPSLP 
       190        200        210        220        230        240 
PSQSTPAWTP RAPSPEDQSH RNTSTCMNIT HSQCQILPYH STLAPLLPIV KNMDMEKFLK 
       250        260        270        280        290        300 
FFTYLHRLSC YQHILLFGCS LAFPECVVDG DDRHGLLPCR SFCEAAKEGC ESVLGMVNSS 
       310        320        330        340        350        360 
WPDSLRCSQF RDHTETNSSV RKSCFSLQQE HGKQSLCGGG ESFLCTSGLC VPKKLQCNGY 
       370        380        390        400        410        420 
NDCDDWSDEA HCNCSKDLFH CGTGKCLHYS LLCDGYDDCG DLSDEQNCDC NLTKEHRCGD 
       430        440        450        460        470        480 
GRCIAAEWVC DGDHDCVDKS DEVNCSCHSQ GLVECRSGQC IPSTFQCDGD EDCKDGSDEE 
       490        500        510        520        530        540 
NCSDSQTPCP EGEQGCLGSS CVESCAGSSL CDSDSSLSNC SQCEPITLEL CMNLPYNHTH 
       550        560        570        580        590        600 
YPNYLGHRTQ KEASISWESS LFPALVQTNC YKYLMFFACT ILVPKCDVNT GQRIPPCRLL 
       610        620        630        640        650        660 
CEHSKERCES VLGIVGLQWP EDTDCNQFPE ESSDNQTCLL PNEDVEECSP SHFKCRSGRC 
       670        680        690        700        710        720 
VLGSRRCDGQ ADCDDDSDEE NCGCKERALW ECPFNKQCLK HTLICDGFPD CPDSMDEKNC 
       730        740        750        760        770        780 
SFCQDNELEC ANHECVPRDL WCDGWVDCSD SSDEWGCVTL SKNGNSSSLL TVHKSAKEHH 
       790        800        810        820        830        840 
VCADGWRETL SQLACKQMGL GEPSVTKLIP GQEGQQWLRL YPNWENLNGS TLQELLVYRH 
       850        860        870        880        890        900 
SCPSRSEISL LCSKQDCGRR PAARMNKRIL GGRTSRPGRW PWQCSLQSEP SGHICGCVLI 
       910        920        930        940        950        960 
AKKWVLTVAH CFEGREDADV WKVVFGINNL DHPSGFMQTR FVKTILLHPR YSRAVVDYDI 
       970        980        990       1000       1010       1020 
SVVELSDDIN ETSYVRPVCL PSPEEYLEPD TYCYITGWGH MGNKMPFKLQ EGEVRIIPLE 
      1030       1040       1050       1060       1070       1080 
QCQSYFDMKT ITNRMICAGY ESGTVDSCMG DSGGPLVCER PGGQWTLFGL TSWGSVCFSK 
      1090       1100       1110    
VLGPGVYSNV SYFVGWIERQ IYIQTFLQKK SQG

Annotation ?

Network neighborhood
[show protein-protein interactions]
 
100
200
300
400
500
600
700
800
900
1000
1100
Chains:
 
 
  
 
N-termini:

N
NN
 
C-termini:
CC
 
Binding & active sites:
   
 
Sequence variations:
     
 
Topology:
   
 
unknown-0GMGRVS...
0,1113

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

0,1113,867,0 CHAIN - Atrial natriuretic peptide-converting enzyme, 180 kDa soluble fragment (By similarity). (0|867)
 
unknown-1MGRVSF...
1,1113

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

1,1113,112,1 TOPO_DOM - Cytoplasmic (Potential). (1|112)
1,1113,89,1 VAR_SEQ - MGRVSFSVRVSSVRRARCSCPGRCYLSCRVPPTTALRALNG LGCAGVPGETAGGAVGPGPLGTRGFLSGSKFQAPGSWKDCF GAPPAPD -> MFTKRPPALAPEEYSRRADAPKR (in isoform 2). (1|89)
1,1113,1113,1 CHAIN - Atrial natriuretic peptide-converting enzyme. (1|1113)
1,1113,867,1 CHAIN - Atrial natriuretic peptide-converting enzyme, N-terminal propeptide (By similarity). (1|867)
 
unknown-868RILGGR...
868,1113

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TNt116381 indirect unknown (unknown)

Affected feature boundaries: ?

868,1113,1113,868 CHAIN - Atrial natriuretic peptide-converting enzyme, activated protease fragment (By similarity). (868|1113)
868,1113,869,868 SITE - Cleavage (By similarity). (868|869)
 

Protein C-Termini [export]

...ARMNK867-unknown
867,1113

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)

Affected feature boundaries: ?

867,1113,867,1 CHAIN - Atrial natriuretic peptide-converting enzyme, N-terminal propeptide (By similarity). (1|867)
867,1113,867,0 CHAIN - Atrial natriuretic peptide-converting enzyme, 180 kDa soluble fragment (By similarity). (0|867)
 
...KKSQG1113-unknown
1113,1113

Evidence: (more...)

Evidence ? Source (database) ? Source (laboratory) ? Name ? Directness of identification ? Phys Relevance Confidence
inferred from electronic annotation UniProtKB inferred from uniprot unknown unknown 0.0 (unknown)
inferred from isoform by sequence similarity TopFIND inferred from TCt67064 indirect unknown (unknown)

Affected feature boundaries: ?

1113,1113,1113,134 TOPO_DOM - Extracellular (Potential). (134|1113)
1113,1113,1113,1 CHAIN - Atrial natriuretic peptide-converting enzyme. (1|1113)
1113,1113,1113,868 CHAIN - Atrial natriuretic peptide-converting enzyme, activated protease fragment (By similarity). (868|1113)
 
Filter by evidence: ?

Directness ?

  • unknown
  • indirect

Physiological relevance ?

  • unknown

Evidencecode ?

Method ?

Perturbation ?

Confidence greater than?

  • unknown

Experimental system ?

Certainty of Protease assignment ?

  • unknown

Evidencecode ?

Tissue distribution ?

Specific evidence ?

Derived from database?

Laboratory ?